Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8462
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF11
Synonyms (NCBI Gene) Gene synonyms aliases
FKLF, FKLF1, MODY7, TIEG2, Tieg3
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MODY7
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p25.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34336420 C>G,T Likely-benign, pathogenic, benign Coding sequence variant, missense variant
rs121912645 G>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016644 hsa-miR-429 Reporter assay 20005803
MIRT020284 hsa-miR-130b-3p Sequencing 20371350
MIRT020356 hsa-miR-200a-3p Reporter assay 20005803
MIRT021077 hsa-miR-200c-3p Reporter assay 20005803
MIRT021660 hsa-miR-141-3p Reporter assay 20005803
Transcription factors
Transcription factor Regulation Reference
NR1H4 Unknown 20060466
STAT3 Activation 18505768
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000083 Process Regulation of transcription involved in G1/S transition of mitotic cell cycle IDA 21171965
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 21171965
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding IDA 21171965
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603301 11811 ENSG00000172059
Protein
UniProt ID O14901
Protein name Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2)
Protein function Transcription factor (PubMed:10207080, PubMed:9748269). Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth (PubMed:1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 394 418 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 424 448 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 454 476 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Higher expression in erythroid cells. {ECO:0000269|PubMed:10207080}.
Sequence
MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQR
SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTR
TPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTG
ESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGG
LLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLP
AFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMA
AGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTG
EKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTK
KIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Sequence length 512
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Hyperinsulinemic hypoglycemia Congenital Hyperinsulinism, Hyperinsulinemic hypoglycemia rs137853103, rs2126234459, rs104894237, rs267607196, rs387906407, rs151344623, rs28936370, rs28938469, rs28936371, rs137852671, rs137852672, rs72559723, rs193922400, rs137852676, rs193922402
View all (71 more)
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent, Transient neonatal diabetes mellitus rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
Kidney disease Kidney Diseases rs74315342, rs749740335, rs757649673, rs112417755, rs35138315
Mason type diabetes MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 7 (disorder), Maturity onset diabetes mellitus in young, MODY rs80356625, rs104894237, rs587776825, rs137853236, rs137853237, rs137853238, rs1566092470, rs1463923467, rs137853243, rs137853244, rs104894006, rs80356655, rs104894008, rs193922254, rs193922259
View all (208 more)
15774581, 21844708
Unknown
Disease term Disease name Evidence References Source
Pancreatic hypoplasia Congenital hypoplasia of pancreas ClinVar
Diabetes maturity-onset diabetes of the young, maturity-onset diabetes of the young type 7 GenCC
Monogenic Diabetes monogenic diabetes GenCC
Neuroticism Neuroticism GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37248295
Alcoholism Associate 23915421
Breast Neoplasms Associate 31640084, 37199905
Colonic Neoplasms Associate 31612481
Depressive Disorder Associate 22348086, 32524199
Depressive Disorder Major Associate 32524199
Diabetes Mellitus Associate 15774581, 29758564, 33604390, 36208030
Diabetes Mellitus Type 2 Associate 15774581, 18199129, 19122346, 19843526, 22348086, 32741144, 35592779, 36208030
Genetic Diseases Inborn Associate 22348086
Insulinoma Associate 39536727