Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8462
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF11
Synonyms (NCBI Gene) Gene synonyms aliases
FKLF, FKLF1, MODY7, TIEG2, Tieg3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p25.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34336420 C>G,T Likely-benign, pathogenic, benign Coding sequence variant, missense variant
rs121912645 G>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016644 hsa-miR-429 Reporter assay 20005803
MIRT020284 hsa-miR-130b-3p Sequencing 20371350
MIRT020356 hsa-miR-200a-3p Reporter assay 20005803
MIRT021077 hsa-miR-200c-3p Reporter assay 20005803
MIRT021660 hsa-miR-141-3p Reporter assay 20005803
Transcription factors
Transcription factor Regulation Reference
NR1H4 Unknown 20060466
STAT3 Activation 18505768
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 21171965
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 9748269
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 21171965
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603301 11811 ENSG00000172059
Protein
UniProt ID O14901
Protein name Krueppel-like factor 11 (Transforming growth factor-beta-inducible early growth response protein 2) (TGFB-inducible early growth response protein 2) (TIEG-2)
Protein function Transcription factor (PubMed:10207080, PubMed:9748269). Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth (PubMed:1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 394 418 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 424 448 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 454 476 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Higher expression in erythroid cells. {ECO:0000269|PubMed:10207080}.
Sequence
MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQR
SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTR
TPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTG
ESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGG
LLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLP
AFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMA
AGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTG
EKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTK
KIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Sequence length 512
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Diabetes maturity-onset diabetes of the young, maturity-onset diabetes of the young type 7 N/A N/A GenCC
Diabetes Mellitus Maturity-onset diabetes of the young type 7, Type 2 diabetes mellitus, diabetes mellitus N/A N/A ClinVar
Mason type diabetes maturity onset diabetes mellitus in young N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37248295
Alcoholism Associate 23915421
Breast Neoplasms Associate 31640084, 37199905
Colonic Neoplasms Associate 31612481
Depressive Disorder Associate 22348086, 32524199
Depressive Disorder Major Associate 32524199
Diabetes Mellitus Associate 15774581, 29758564, 33604390, 36208030
Diabetes Mellitus Type 2 Associate 15774581, 18199129, 19122346, 19843526, 22348086, 32741144, 35592779, 36208030
Genetic Diseases Inborn Associate 22348086
Insulinoma Associate 39536727