Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84619
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger CCCH-type and G-patch domain containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZGPAT
Synonyms (NCBI Gene) Gene synonyms aliases	GPATC6, GPATCH6, KIAA1847, ZC3H9, ZC3HDC9, ZIP
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.33

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments
MIRT2374669	hsa-miR-1207-5p	CLIP-seq
MIRT2374670	hsa-miR-141	CLIP-seq
MIRT2374671	hsa-miR-200a	CLIP-seq
MIRT2374672	hsa-miR-214	CLIP-seq
MIRT2374673	hsa-miR-3120-5p	CLIP-seq
MIRT2374674	hsa-miR-3619-5p	CLIP-seq
MIRT2374675	hsa-miR-365	CLIP-seq
MIRT2374676	hsa-miR-3663-5p	CLIP-seq
MIRT2374677	hsa-miR-3665	CLIP-seq
MIRT2374678	hsa-miR-4291	CLIP-seq
MIRT2374679	hsa-miR-4480	CLIP-seq
MIRT2374680	hsa-miR-4519	CLIP-seq
MIRT2374681	hsa-miR-4660	CLIP-seq
MIRT2374682	hsa-miR-4667-3p	CLIP-seq
MIRT2374683	hsa-miR-4736	CLIP-seq
MIRT2374684	hsa-miR-4749-3p	CLIP-seq
MIRT2374685	hsa-miR-4763-3p	CLIP-seq
MIRT2374686	hsa-miR-502-5p	CLIP-seq
MIRT2374687	hsa-miR-512-5p	CLIP-seq
MIRT2374688	hsa-miR-541	CLIP-seq
MIRT2374689	hsa-miR-654-5p	CLIP-seq
MIRT2374690	hsa-miR-761	CLIP-seq
MIRT2374691	hsa-miR-922	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	19644445
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19644445
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	19644445
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	19644445
GO:0005515	Function	Protein binding	IPI	19644445, 21516116, 25416956, 26871637, 28514442, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19644445
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0007175	Process	Negative regulation of epidermal growth factor-activated receptor activity	IDA	19644445
GO:0008270	Function	Zinc ion binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	19644445
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	19644445
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
619577	15948	ENSG00000197114

Protein

UniProt ID

Q8N5A5

Protein name

Zinc finger CCCH-type with G patch domain-containing protein (G patch domain-containing protein 6) (Zinc finger CCCH domain-containing protein 9) (Zinc finger and G patch domain-containing protein)

Protein function

Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene invol

PDB

4II1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18044	zf-CCCH_4	178 → 199	CCCH-type zinc finger	Domain
PF01585	G-patch	333 → 376	G-patch domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:19644445}.

Sequence

MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKS
SLLAALDEERPGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEE
EEGEDEEELSGTKVSAPYYSSWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPC
PFFLEGKCRFKENCRFSHGQVVSLDELRPFQDPDLSSLQAGSACLAKHQDGLWHAARITD
VDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSA
QSSALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRV
EPIHAVVLPRGKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNE
KLQGQAPGALEAGAAPAGRRSKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEAL
ARNAGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF

Sequence length

531

Interactions

View interactions

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease (MTAG), Inflammatory bowel disease	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthritis Rheumatoid	Associate	20187130
Colitis Ulcerative	Associate	18758464
Crohn Disease	Associate	18758464
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	20233718
Inflammatory Bowel Diseases	Associate	18758464

ZGPAT (zinc finger CCCH-type and G-patch domain containing)