TPST1 (tyrosylprotein sulfotransferase 1)

Gene

• Entrez ID: 8460
• Gene name: Tyrosylprotein sulfotransferase 1
• Gene symbol: TPST1
• Synonyms (NCBI Gene): TANGO13A
• Chromosome: 7
• Chromosome location: 7q11.21

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022966	hsa-miR-124-3p	Microarray	18668037
MIRT2134647	hsa-miR-4496	CLIP-seq
MIRT2649389	hsa-miR-3691-3p	CLIP-seq
MIRT2649390	hsa-miR-3925-5p	CLIP-seq
MIRT2649391	hsa-miR-4311	CLIP-seq
MIRT2649392	hsa-miR-4428	CLIP-seq
MIRT2649393	hsa-miR-4661-3p	CLIP-seq
MIRT2649394	hsa-miR-4700-3p	CLIP-seq
MIRT2649395	hsa-miR-4714-3p	CLIP-seq
MIRT2649396	hsa-miR-495	CLIP-seq
MIRT2649397	hsa-miR-5095	CLIP-seq
MIRT2649398	hsa-miR-570	CLIP-seq
MIRT2649399	hsa-miR-598	CLIP-seq
MIRT2649400	hsa-miR-600	CLIP-seq
MIRT2649401	hsa-miR-607	CLIP-seq
MIRT2649389	hsa-miR-3691-3p	CLIP-seq
MIRT2649392	hsa-miR-4428	CLIP-seq
MIRT2649393	hsa-miR-4661-3p	CLIP-seq
MIRT2649394	hsa-miR-4700-3p	CLIP-seq
MIRT2649395	hsa-miR-4714-3p	CLIP-seq
MIRT2649396	hsa-miR-495	CLIP-seq
MIRT2649397	hsa-miR-5095	CLIP-seq
MIRT2649398	hsa-miR-570	CLIP-seq
MIRT2649399	hsa-miR-598	CLIP-seq
MIRT2649400	hsa-miR-600	CLIP-seq
MIRT2649401	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IBA	21873635
GO:0006478	Process	Peptidyl-tyrosine sulfation	IBA	21873635
GO:0006478	Process	Peptidyl-tyrosine sulfation	IDA	9501187
GO:0006954	Process	Inflammatory response	TAS	9501187
GO:0008146	Function	Sulfotransferase activity	IBA	21873635
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	IBA	21873635
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	IDA	9501187
GO:0016020	Component	Membrane	TAS	9501187
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0030173	Component	Integral component of Golgi membrane	IDA	16859706
GO:0042803	Function	Protein homodimerization activity	IPI	28821720
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS

Other IDs

• MIM: 603125
• HGNC: 12020
• e!Ensembl: ENSG00000169902

Protein

• UniProt ID: O60507
• Protein name: Protein-tyrosine sulfotransferase 1 (EC 2.8.2.20) (Tyrosylprotein sulfotransferase 1) (TPST-1)
• Protein function: Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.
• PDB: 5WRI, 5WRJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13469	Sulfotransfer_3	70 → 263		Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:9501187}.
• Sequence:

  MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKAN
  KTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKE
  KIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFL
  LMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYE
  QLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALS
  KWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQLPDFL
  KEKPQTEQVE

• Sequence length: 370

Pathways

Reactome:

Cytosolic sulfonation of small molecules

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Gout	Gout			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	39287711
Arthritis Rheumatoid	Associate	17082220, 36969166
Asthma	Associate	39893495
Calcinosis Cutis	Associate	23472069
Drug Hypersensitivity	Associate	39893495
Idiopathic Pulmonary Fibrosis	Associate	36035368
Nasopharyngeal Carcinoma	Associate	23472069
Neoplasm Metastasis	Associate	23472069
Obesity	Associate	39893495
Subarachnoid Hemorrhage	Associate	34542421
Urinary Bladder Neoplasms	Associate	31333338, 35127296, 35958598, 39368544