Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8460
Gene name Gene Name - the full gene name approved by the HGNC.	Tyrosylprotein sulfotransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TPST1
Synonyms (NCBI Gene) Gene synonyms aliases	TANGO13A
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q11.21

Show/Hide all(26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022966	hsa-miR-124-3p	Microarray	18668037
MIRT2134647	hsa-miR-4496	CLIP-seq
MIRT2649389	hsa-miR-3691-3p	CLIP-seq
MIRT2649390	hsa-miR-3925-5p	CLIP-seq
MIRT2649391	hsa-miR-4311	CLIP-seq
MIRT2649392	hsa-miR-4428	CLIP-seq
MIRT2649393	hsa-miR-4661-3p	CLIP-seq
MIRT2649394	hsa-miR-4700-3p	CLIP-seq
MIRT2649395	hsa-miR-4714-3p	CLIP-seq
MIRT2649396	hsa-miR-495	CLIP-seq
MIRT2649397	hsa-miR-5095	CLIP-seq
MIRT2649398	hsa-miR-570	CLIP-seq
MIRT2649399	hsa-miR-598	CLIP-seq
MIRT2649400	hsa-miR-600	CLIP-seq
MIRT2649401	hsa-miR-607	CLIP-seq
MIRT2649389	hsa-miR-3691-3p	CLIP-seq
MIRT2649392	hsa-miR-4428	CLIP-seq
MIRT2649393	hsa-miR-4661-3p	CLIP-seq
MIRT2649394	hsa-miR-4700-3p	CLIP-seq
MIRT2649395	hsa-miR-4714-3p	CLIP-seq
MIRT2649396	hsa-miR-495	CLIP-seq
MIRT2649397	hsa-miR-5095	CLIP-seq
MIRT2649398	hsa-miR-570	CLIP-seq
MIRT2649399	hsa-miR-598	CLIP-seq
MIRT2649400	hsa-miR-600	CLIP-seq
MIRT2649401	hsa-miR-607	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	16859706
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	IBA
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	IDA	9501187
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	IEA
GO:0008476	Function	Protein-tyrosine sulfotransferase activity	TAS	9733778
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9501187
GO:0016740	Function	Transferase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	28821720
GO:0043687	Process	Post-translational protein modification	IDA	9501187
GO:0043687	Process	Post-translational protein modification	IEA
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IEA
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS

MIM	HGNC	e!Ensembl
603125	12020	ENSG00000169902

Protein

UniProt ID

O60507

Protein name

Protein-tyrosine sulfotransferase 1 (EC 2.8.2.20) (Tyrosylprotein sulfotransferase 1) (TPST-1)

Protein function

Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.

PDB

5WRI , 5WRJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13469	Sulfotransfer_3	70 → 263		Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:9501187}.

Sequence

MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKAN
KTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKE
KIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFL
LMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYE
QLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALS
KWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQLPDFL
KEKPQTEQVE

Sequence length

370

Interactions

View interactions

	Reactome
			Cytosolic sulfonation of small molecules

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Gout	Gout	N/A	N/A	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	39287711
Arthritis Rheumatoid	Associate	17082220, 36969166
Asthma	Associate	39893495
Calcinosis Cutis	Associate	23472069
Drug Hypersensitivity	Associate	39893495
Idiopathic Pulmonary Fibrosis	Associate	36035368
Nasopharyngeal Carcinoma	Associate	23472069
Neoplasm Metastasis	Associate	23472069
Obesity	Associate	39893495
Subarachnoid Hemorrhage	Associate	34542421
Urinary Bladder Neoplasms	Associate	31333338, 35127296, 35958598, 39368544

TPST1 (tyrosylprotein sulfotransferase 1)