PGBD1 (piggyBac transposable element derived 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84547
Gene name Gene Name - the full gene name approved by the HGNC.
PiggyBac transposable element derived 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PGBD1
Synonyms (NCBI Gene) Gene synonyms aliases
HUCEP-4, SCAND4, dJ874C20.4
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(44)
miRTarBase ID miRNA Experiments Reference
MIRT495996 hsa-miR-3146 PAR-CLIP 22291592
MIRT495995 hsa-miR-676-5p PAR-CLIP 22291592
MIRT495993 hsa-miR-4733-5p PAR-CLIP 22291592
MIRT495996 hsa-miR-3146 PAR-CLIP 22291592
MIRT495995 hsa-miR-676-5p PAR-CLIP 22291592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005515 Function Protein binding IPI 25416956, 25910212, 26871637, 28514442, 31515488, 32296183, 33961781
GO:0006357 Process Regulation of transcription by RNA polymerase II NAS 34673265
GO:0016020 Component Membrane IEA
GO:0042802 Function Identical protein binding IPI 25416956, 31515488, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
621244 19398 ENSG00000137338
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96JS3
Protein name PiggyBac transposable element-derived protein 1 (Cerebral protein 4)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 40 → 129 SCAN domain Domain
PF13843 DDE_Tnp_1_7 418 → 775 Transposase IS4 Domain
Sequence 
MYEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHFCYQEAHGPQE
ALAQLRELCHQWLRPEMHTKEQIMELLVLEQFLTILPKELQPCVKTYPLESGEEAVTVLE
NLETGSGDTGQQASVYIQGQDMHPMVAEYQGVSLECQSLQLLPGITTLKCEPPQRPQGNP
QEVSGPVPHGSAHLQEKNPRDKAVVPVFNPVRSQTLVKTEEETAQAVAAEKWSHLSLTRR
NLCGNSAQETVMSLSPMTEEIVTKDRLFKAKQETSEEMEQSGEASGKPNRECAPQIPCST
PIATERTVAHLNTLKDRHPGDLWARMHISSLEYAAGDITRKGRKKDKARVSELLQGLSFS
GDSDVEKDNEPEIQPAQKKLKVSCFPEKSWTKRDIKPNFPSWSALDSGLLNLKSEKLNPV
ELFELFFDDETFNLIVNETNNYASQKNVSLEVTVQEMRCVFGVLLLSGFMRHPRREMYWE
VSDTDQNLVRDAIRRDRFELIFSNLHFADNGHLDQKDKFTKLRPLIKQMNKNFLLYAPLE
EYYCFDKSMCECFDSDQFLNGKPIRIGYKIWCGTTTQGYLVWFEPYQEESTMKVDEDPDL
GLGGNLVMNFADVLLERGQYPYHLCFDSFFTSVKLLSALKKKGVRATGTIRENRTEKCPL
MNVEHMKKMKRGYFDFRIEENNEIILCRWYGDGIISLCSNAVGIEPVNEVSCCDADNEEI
PQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHRA
CNPGASLDPLDFRRFVAHFYLEHNAHLSD
Sequence length 809
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mental Depression Major depressive disorder N/A N/A GWAS
Myopia Myopia N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 18830724
Breast Neoplasms Associate 37223020
Hemochromatosis Associate 18990219