Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84516
Gene name Gene Name - the full gene name approved by the HGNC.
Dynactin subunit 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DCTN5
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p12.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019580 hsa-miR-340-5p Sequencing 20371350
MIRT020007 hsa-miR-375 Microarray 20215506
MIRT023378 hsa-miR-122-5p Microarray 17612493
MIRT051842 hsa-let-7c-5p CLASH 23622248
MIRT045566 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IEA
GO:0003281 Process Ventricular septum development IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612962 24594 ENSG00000166847
Protein
UniProt ID Q9BTE1
Protein name Dynactin subunit 5 (Dynactin subunit p25)
Protein function Part of the dynactin complex that activates the molecular motor dynein for ultra-processive transport along microtubules.
PDB 5NW4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00132 Hexapep 84 118 Bacterial transferase hexapeptide (six repeats) Repeat
PF00132 Hexapep 100 130 Bacterial transferase hexapeptide (six repeats) Repeat
PF00132 Hexapep 107 142 Bacterial transferase hexapeptide (six repeats) Repeat
Sequence
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILD
NTVLPPETVVPP
FTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV
Sequence length 182
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Motor proteins
Vasopressin-regulated water reabsorption
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases
Salmonella infection
  MHC class II antigen presentation
HSP90 chaperone cycle for steroid hormone receptors (SHR)
COPI-mediated anterograde transport
COPI-independent Golgi-to-ER retrograde traffic
<