Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8445
Gene name Gene Name - the full gene name approved by the HGNC.
Dual specificity tyrosine phosphorylation regulated kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DYRK2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q15
Summary Summary of gene provided in NCBI Entrez Gene.
DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine res
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027110 hsa-miR-103a-3p Sequencing 20371350
MIRT027686 hsa-miR-98-5p Microarray 19088304
MIRT028150 hsa-miR-93-5p Sequencing 20371350
MIRT051470 hsa-let-7e-5p CLASH 23622248
MIRT028150 hsa-miR-93-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IDA 19287380
GO:0000287 Function Magnesium ion binding IDA 9748265
GO:0004674 Function Protein serine/threonine kinase activity IBA 21873635
GO:0004674 Function Protein serine/threonine kinase activity IDA 11311121
GO:0004674 Function Protein serine/threonine kinase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603496 3093 ENSG00000127334
Protein
UniProt ID Q92630
Protein name Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1)
Protein function Serine/threonine-protein kinase involved in the regulation of the mitotic cell cycle, cell proliferation, apoptosis, organization of the cytoskeleton and neurite outgrowth. Functions in part via its role in ubiquitin-dependent proteasomal protei
PDB 3K2L , 3KVW , 4AZF , 5LXC , 5LXD , 5ZTN , 6HDP , 6HDR , 6K0J , 7AKF , 7AKH , 7DG4 , 7DH3 , 7DH9 , 7DHC , 7DHH , 7DHK , 7DHN , 7DHO , 7DHV , 7DJO , 7DL6 , 8HLT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 222 535 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Testis, after the onset of spermatogenesis. {ECO:0000269|PubMed:9748265}.
Sequence
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWL
RRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
Sequence length 601
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of TP53 Activity through Phosphorylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Gastrointestinal stromal tumor Gastrointestinal Stromal Tumors, Gastrointestinal Stromal Sarcoma rs587776653, rs74315368, rs74315369, rs587776793, rs587776794, rs587776795, rs606231209, rs121908589, rs121913685, rs121913680, rs794726675, rs587776804, rs121913517, rs121913234, rs121913512
View all (59 more)
27793025
Glioblastoma Glioblastoma Multiforme rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 19818968
Adenocarcinoma of Lung Associate 27532268
Breast Neoplasms Associate 25095982
Carcinoma Non Small Cell Lung Associate 19596956
Carcinoma Non Small Cell Lung Stimulate 27532268
Colorectal Neoplasms Inhibit 27532268
Colorectal Neoplasms Associate 36934104
Diabetes Mellitus Type 1 Associate 35903753
Gastrointestinal Stromal Tumors Associate 14724156
Leukemia Myeloid Acute Associate 35364561