Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84446
Gene name Gene Name - the full gene name approved by the HGNC.	BR serine/threonine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BRSK1
Synonyms (NCBI Gene) Gene synonyms aliases	SAD-B, hSAD1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.42

Show/Hide all(49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042770	hsa-miR-339-5p	CLASH	23622248
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT485951	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT485952	hsa-miR-4779	PAR-CLIP	23592263
MIRT485950	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT485949	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT485948	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT485947	hsa-miR-6077	PAR-CLIP	23592263
MIRT485946	hsa-miR-765	PAR-CLIP	23592263
MIRT485944	hsa-miR-1538	PAR-CLIP	23592263
MIRT485945	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT485943	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485942	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT615184	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT615184	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT615184	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	27418678
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	27418678
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	27418678
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT485951	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT485952	hsa-miR-4779	PAR-CLIP	23592263
MIRT485950	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT485949	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT485948	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT485947	hsa-miR-6077	PAR-CLIP	23592263
MIRT485946	hsa-miR-765	PAR-CLIP	23592263
MIRT485944	hsa-miR-1538	PAR-CLIP	23592263
MIRT485945	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT485943	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485942	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT825492	hsa-miR-1247	CLIP-seq
MIRT825493	hsa-miR-1470	CLIP-seq
MIRT825494	hsa-miR-361-3p	CLIP-seq
MIRT825495	hsa-miR-4267	CLIP-seq
MIRT825496	hsa-miR-4667-3p	CLIP-seq
MIRT825493	hsa-miR-1470	CLIP-seq
MIRT825494	hsa-miR-361-3p	CLIP-seq
MIRT825496	hsa-miR-4667-3p	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	15150265
GO:0000287	Function	Magnesium ion binding	IDA	14976552
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	15150265
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0005524	Function	ATP binding	IC	15150265
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	15150265
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	15150265
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	ISS
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	15150265
GO:0006468	Process	Protein phosphorylation	TAS	27626661
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	15150265
GO:0007095	Process	Mitotic G2 DNA damage checkpoint	IDA	15150265
GO:0007269	Process	Neurotransmitter secretion	ISS
GO:0007409	Process	Axonogenesis	IBA	21873635
GO:0007409	Process	Axonogenesis	ISS
GO:0008021	Component	Synaptic vesicle	ISS
GO:0008021	Component	Synaptic vesicle	TAS	26444684, 27626661
GO:0008306	Process	Associative learning	ISS
GO:0009411	Process	Response to UV	IDA	15150265
GO:0010212	Process	Response to ionizing radiation	IDA	15150265
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15150265
GO:0019901	Function	Protein kinase binding	IEA
GO:0030010	Process	Establishment of cell polarity	IBA	21873635
GO:0030010	Process	Establishment of cell polarity	ISS
GO:0030054	Component	Cell junction	IDA
GO:0030182	Process	Neuron differentiation	ISS
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0042149	Process	Cellular response to glucose starvation	IBA	21873635
GO:0043015	Function	Gamma-tubulin binding	ISS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048786	Component	Presynaptic active zone	TAS	26444684, 27626661
GO:0050321	Function	Tau-protein kinase activity	IBA	21873635
GO:0050321	Function	Tau-protein kinase activity	IDA	21985311
GO:0050321	Function	Tau-protein kinase activity	ISS
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050770	Process	Regulation of axonogenesis	ISS
GO:0051298	Process	Centrosome duplication	ISS
GO:0090176	Process	Microtubule cytoskeleton organization involved in establishment of planar polarity	ISS
GO:0099504	Process	Synaptic vesicle cycle	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:0150034	Component	Distal axon	ISS
GO:2000807	Process	Regulation of synaptic vesicle clustering	TAS	18268107

MIM	HGNC	e!Ensembl
609235	18994	ENSG00000160469

Protein

UniProt ID

Q8TDC3

Protein name

Serine/threonine-protein kinase BRSK1 (EC 2.7.11.1) (Brain-selective kinase 1) (EC 2.7.11.26) (Brain-specific serine/threonine-protein kinase 1) (BR serine/threonine-protein kinase 1) (Serine/threonine-protein kinase SAD-B) (Synapses of Amphids Defective

Protein function

Serine/threonine-protein kinase that plays a key role in polarization of neurons and centrosome duplication. Phosphorylates CDC25B, CDC25C, MAPT/TAU, RIMS1, TUBG1, TUBG2 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	34 → 285	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels in brain and testis. Protein levels remain constant throughout the cell cycle. {ECO:0000269|PubMed:15150265}.

Sequence

MSSGAKEGGGGSPAYHLPHPHPHPPQHAQYVGPYRLEKTLGKGQTGLVKLGVHCITGQKV
AIKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFD
YLVKKGRLTPKEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASL
QVGDSLLETSCGSPHYACPEVIKGEKYDGRRADMWSCGVILFALLVGALPFDDDNLRQLL
EKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAP
GRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKER
YPSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRA
LEMAQHSQRSRSVSGASTGLSSSPLSSPRSPVFSFSPEPGAGDEARGGGSPTSKTQTLPS
RGPRGGGAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSP
GGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFI
SLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKP
VRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTHDQP
SVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELSSSPRRGPPKDKKLLATNGTPLP

Sequence length

778

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID
Causal
Gastric cancer	Gastric Adenocarcinoma	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)
Lung carcinoma	Large cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Osteoarthritis Of Hip	Osteoarthritis Of Hip		GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	19448619
Cardiovascular Diseases	Associate	19448619
Glomerulonephritis Membranous	Associate	30865617
Inflammation	Associate	30865617
Mitochondrial Diseases	Associate	37140697
Myopathy with Giant Abnormal Mitochondria	Associate	37140697
Neoplasms	Stimulate	37140697
Neoplasms	Associate	40095483
Uterine Cervical Neoplasms	Associate	37140697

BRSK1 (BR serine/threonine kinase 1)