Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	84446
Gene name	BR serine/threonine kinase 1
Gene symbol	BRSK1
Synonyms (NCBI Gene)	SAD-BhSAD1
Chromosome	19
Chromosome location	19q13.42

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042770	hsa-miR-339-5p	CLASH	23622248
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT485951	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT485952	hsa-miR-4779	PAR-CLIP	23592263
MIRT485950	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT485949	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT485948	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT485947	hsa-miR-6077	PAR-CLIP	23592263
MIRT485946	hsa-miR-765	PAR-CLIP	23592263
MIRT485944	hsa-miR-1538	PAR-CLIP	23592263
MIRT485945	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT485943	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485942	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT615184	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT615184	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT615184	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	27418678
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	27418678
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	27418678
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT615185	hsa-miR-4632-3p	HITS-CLIP	23824327
MIRT615184	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT485951	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT485952	hsa-miR-4779	PAR-CLIP	23592263
MIRT485950	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT485949	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT485948	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT485947	hsa-miR-6077	PAR-CLIP	23592263
MIRT485946	hsa-miR-765	PAR-CLIP	23592263
MIRT485944	hsa-miR-1538	PAR-CLIP	23592263
MIRT485945	hsa-miR-4745-3p	PAR-CLIP	23592263
MIRT485943	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT485942	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT825492	hsa-miR-1247	CLIP-seq
MIRT825493	hsa-miR-1470	CLIP-seq
MIRT825494	hsa-miR-361-3p	CLIP-seq
MIRT825495	hsa-miR-4267	CLIP-seq
MIRT825496	hsa-miR-4667-3p	CLIP-seq
MIRT825493	hsa-miR-1470	CLIP-seq
MIRT825494	hsa-miR-361-3p	CLIP-seq
MIRT825496	hsa-miR-4667-3p	CLIP-seq

Show/Hide all (83)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA
GO:0000086	Process	G2/M transition of mitotic cell cycle	IDA	15150265
GO:0000086	Process	G2/M transition of mitotic cell cycle	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	14976552
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	15150265, 27626661
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0005524	Function	ATP binding	IC	15150265
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	15150265
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	15150265
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	IDA	15150265
GO:0006974	Process	DNA damage response	IDA	15150265
GO:0006974	Process	DNA damage response	IEA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IDA	15150265
GO:0007269	Process	Neurotransmitter secretion	IEA
GO:0007269	Process	Neurotransmitter secretion	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007409	Process	Axonogenesis	IBA
GO:0007409	Process	Axonogenesis	IEA
GO:0007409	Process	Axonogenesis	ISS
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008021	Component	Synaptic vesicle	ISS
GO:0008021	Component	Synaptic vesicle	TAS	26444684, 27626661
GO:0008306	Process	Associative learning	IEA
GO:0008306	Process	Associative learning	ISS
GO:0009411	Process	Response to UV	IDA	15150265
GO:0009411	Process	Response to UV	IDA	15150265
GO:0010212	Process	Response to ionizing radiation	IDA	15150265
GO:0010807	Process	Regulation of synaptic vesicle priming	IEA
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15150265
GO:0019901	Function	Protein kinase binding	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030010	Process	Establishment of cell polarity	ISS
GO:0030054	Component	Cell junction	IDA
GO:0030182	Process	Neuron differentiation	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043015	Function	Gamma-tubulin binding	IEA
GO:0043015	Function	Gamma-tubulin binding	ISS
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048786	Component	Presynaptic active zone	IEA
GO:0048786	Component	Presynaptic active zone	TAS	26444684, 27626661
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0050321	Function	Tau-protein kinase activity	IBA
GO:0050321	Function	Tau-protein kinase activity	IDA	21985311
GO:0050321	Function	Tau-protein kinase activity	ISS
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0050770	Process	Regulation of axonogenesis	ISS
GO:0051298	Process	Centrosome duplication	IEA
GO:0051298	Process	Centrosome duplication	ISS
GO:0090176	Process	Microtubule cytoskeleton organization involved in establishment of planar polarity	IEA
GO:0090176	Process	Microtubule cytoskeleton organization involved in establishment of planar polarity	ISS
GO:0098981	Component	Cholinergic synapse	IEA
GO:0099504	Process	Synaptic vesicle cycle	IEA
GO:0099504	Process	Synaptic vesicle cycle	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0150034	Component	Distal axon	IEA
GO:0150034	Component	Distal axon	ISS
GO:2000807	Process	Regulation of synaptic vesicle clustering	IEA
GO:2000807	Process	Regulation of synaptic vesicle clustering	TAS	18268107

MIM	HGNC	e!Ensembl
609235	18994	ENSG00000160469

Q8TDC3

Protein name

Serine/threonine-protein kinase BRSK1 (EC 2.7.11.1) (Brain-selective kinase 1) (EC 2.7.11.26) (Brain-specific serine/threonine-protein kinase 1) (BR serine/threonine-protein kinase 1) (Serine/threonine-protein kinase SAD-B) (Synapses of Amphids Defective

Protein function

Serine/threonine-protein kinase that plays a key role in polarization of neurons and centrosome duplication. Phosphorylates CDC25B, CDC25C, MAPT/TAU, RIMS1, TUBG1, TUBG2 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	34 → 285	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels in brain and testis. Protein levels remain constant throughout the cell cycle. {ECO:0000269|PubMed:15150265}.

Sequence

MSSGAKEGGGGSPAYHLPHPHPHPPQHAQYVGPYRLEKTLGKGQTGLVKLGVHCITGQKV
AIKIVNREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFD
YLVKKGRLTPKEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASL
QVGDSLLETSCGSPHYACPEVIKGEKYDGRRADMWSCGVILFALLVGALPFDDDNLRQLL
EKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAP
GRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKER
YPSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRA
LEMAQHSQRSRSVSGASTGLSSSPLSSPRSPVFSFSPEPGAGDEARGGGSPTSKTQTLPS
RGPRGGGAGEQPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSP
GGGVGGAAWRSRLNSIRNSFLGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFI
SLDKEEQIFLVLKDKPLSSIKADIVHAFLSIPSLSHSVLSQTSFRAEYKASGGPSVFQKP
VRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQAQLLSTHDQP
SVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELSSSPRRGPPKDKKLLATNGTPLP

Sequence length

778

Interactions

View interactions

BRSK1 (BR serine/threonine kinase 1)