PROK1 (prokineticin 1)

Gene

• Entrez ID: 84432
• Gene name: Prokineticin 1
• Gene symbol: PROK1
• Synonyms (NCBI Gene): EGVEGF, PK1, PRK1
• Chromosome: 1
• Chromosome location: 1p13.3
• Summary: The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1265048	hsa-miR-3162-3p	CLIP-seq
MIRT1265049	hsa-miR-3179	CLIP-seq
MIRT1265050	hsa-miR-378g	CLIP-seq
MIRT1265051	hsa-miR-4292	CLIP-seq
MIRT1265052	hsa-miR-4308	CLIP-seq
MIRT1265053	hsa-miR-4437	CLIP-seq
MIRT1265054	hsa-miR-4674	CLIP-seq
MIRT1265055	hsa-miR-4757-5p	CLIP-seq
MIRT1265056	hsa-miR-509-3p	CLIP-seq
MIRT2077915	hsa-miR-3127-5p	CLIP-seq
MIRT2077916	hsa-miR-4656	CLIP-seq
MIRT1265056	hsa-miR-509-3p	CLIP-seq
MIRT2077917	hsa-miR-924	CLIP-seq
MIRT2077915	hsa-miR-3127-5p	CLIP-seq
MIRT2304445	hsa-miR-3664-3p	CLIP-seq
MIRT2077916	hsa-miR-4656	CLIP-seq
MIRT2393047	hsa-miR-1228	CLIP-seq
MIRT2393048	hsa-miR-377	CLIP-seq
MIRT2393049	hsa-miR-4701-5p	CLIP-seq
MIRT2393050	hsa-miR-588	CLIP-seq
MIRT2457217	hsa-miR-1224-3p	CLIP-seq
MIRT2457218	hsa-miR-1260	CLIP-seq
MIRT2457219	hsa-miR-1260b	CLIP-seq
MIRT2457220	hsa-miR-1280	CLIP-seq
MIRT2457221	hsa-miR-378	CLIP-seq
MIRT2457222	hsa-miR-378b	CLIP-seq
MIRT2457223	hsa-miR-378c	CLIP-seq
MIRT2457224	hsa-miR-378d	CLIP-seq
MIRT2457225	hsa-miR-378e	CLIP-seq
MIRT2457226	hsa-miR-378f	CLIP-seq
MIRT2457227	hsa-miR-378h	CLIP-seq
MIRT2457228	hsa-miR-378i	CLIP-seq
MIRT2457229	hsa-miR-422a	CLIP-seq
MIRT2457230	hsa-miR-4520a-3p	CLIP-seq
MIRT2457231	hsa-miR-4638-3p	CLIP-seq
MIRT2457232	hsa-miR-532-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001935	Process	Endothelial cell proliferation	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0101023	Process	Vascular endothelial cell proliferation	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IEA

Other IDs

• MIM: 606233
• HGNC: 18454
• e!Ensembl: ENSG00000143125

Protein

• UniProt ID: P58294
• Protein name: Prokineticin-1 (Endocrine-gland-derived vascular endothelial growth factor) (EG-VEGF) (Mambakine)
• Protein function: Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a vari
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06607	Prokineticin	1 → 97	Prokineticin	Family

• Tissue specificity: TISSUE SPECIFICITY: Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic
• Sequence:

  MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEEC
  HPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF

• Sequence length: 105

Pathways

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	24496457	★☆☆☆☆ Found in Text Mining only
Abortion Habitual	Associate	25064403	★☆☆☆☆ Found in Text Mining only
Abortion Habitual	Stimulate	25128195	★☆☆☆☆ Found in Text Mining only
Abortion Spontaneous	Associate	25064403, 25128195, 28782224	★☆☆☆☆ Found in Text Mining only
ACTH Secreting Pituitary Adenoma	Associate	26475302	★☆☆☆☆ Found in Text Mining only
Adrenal Gland Diseases	Associate	26475302	★☆☆☆☆ Found in Text Mining only
Adrenocortical Adenoma	Associate	26475302	★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	26475302	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Associate	35983033	★☆☆☆☆ Found in Text Mining only
Bacterial Infections	Associate	21983634	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Associate	24496457	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	22990536	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	26318037, 29226856, 34657605	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Stimulate	26047640	★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	19285664, 20400074, 37662927	★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Associate	22941044, 28782224, 31991505	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	35845958	★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Associate	26318037	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Associate	21858136	★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	28782224	★☆☆☆☆ Found in Text Mining only
Infertility	Associate	34782535	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	18339712, 21983634	★☆☆☆☆ Found in Text Mining only
Neointima	Associate	12759245	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	26318037, 34657605	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24496457, 29226856, 30838843, 34657605, 35845958	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	26475302	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	30551529	★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Associate	36233195	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	22990536	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	30551529, 35146962	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Associate	29226856	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Associate	30838843	★☆☆☆☆ Found in Text Mining only
Placenta Diseases	Associate	34955534	★☆☆☆☆ Found in Text Mining only
Plaque Amyloid	Associate	27743375	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	12759245	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Stimulate	19602057	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Associate	28782224, 31991505	★☆☆☆☆ Found in Text Mining only
Pregnancy Complications	Associate	28782224, 31991505	★☆☆☆☆ Found in Text Mining only
Premature Birth	Associate	28782224	★☆☆☆☆ Found in Text Mining only
Trophoblastic Neoplasms	Associate	34955534	★☆☆☆☆ Found in Text Mining only