Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8438
Gene name Gene Name - the full gene name approved by the HGNC.
RAD54 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RAD54L
Synonyms (NCBI Gene) Gene synonyms aliases
HR54, RAD54A, hHR54, hRAD54
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to pla
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121908688 C>A Pathogenic 5 prime UTR variant, missense variant, genic upstream transcript variant, coding sequence variant
rs121908689 T>A Pathogenic Missense variant, coding sequence variant
rs121908690 G>A Pathogenic Missense variant, coding sequence variant
rs374567435 C>T Likely-pathogenic Coding sequence variant, missense variant
rs797044888 G>A,T Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028893 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000724 Process Double-strand break repair via homologous recombination IEA
GO:0003677 Function DNA binding IEA
GO:0004386 Function Helicase activity IEA
GO:0005515 Function Protein binding IPI 16990250, 22153077, 25416956, 28514442, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603615 9826 ENSG00000085999
Protein
UniProt ID Q92698
Protein name DNA repair and recombination protein RAD54-like (EC 3.6.4.12) (RAD54 homolog) (hHR54) (hRAD54)
Protein function Plays an essential role in homologous recombination (HR) which is a major pathway for repairing DNA double-strand breaks (DSBs), single-stranded DNA (ssDNA) gaps, and stalled or collapsed replication forks (PubMed:11459989, PubMed:12205100, PubM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00176 SNF2_N 156 463 SNF2 family N-terminal domain Family
PF00271 Helicase_C 496 611 Helicase conserved C-terminal domain Family
Sequence
MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTN
QPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVL
YEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCI
MADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQP
LAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHR
LKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELP
ILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ
TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALI
YDKCVEEEDGFVGALDL
FPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLY
VRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPAND
EQAMARVWRDG
QKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGE
LKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVL
QAAWDAASTAITFVFHQRSHEEQRGLR
Sequence length 747
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Homologous recombination  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
non-hodgkin lymphoma Non-Hodgkin lymphoma rs121908689 N/A
Adenocarcinoma Of Colon Colon adenocarcinoma rs121908688 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Brain Neoplasms Associate 29287594
Breast Neoplasms Associate 10507777, 12614485, 29287594, 32932728, 34282249
Carcinoma Non Small Cell Lung Associate 21412013
Carcinoma Non Small Cell Lung Stimulate 33658396
Colonic Neoplasms Associate 32758138
Colorectal Neoplasms Associate 26046797, 32758138, 35567913
Dermatitis Contact Associate 33318199
Drug Hypersensitivity Associate 33318199
Esophageal Squamous Cell Carcinoma Associate 23504502
Hereditary Breast and Ovarian Cancer Syndrome Associate 33326660, 35893033