Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8435
Gene name Gene Name - the full gene name approved by the HGNC.	Sterol O-acyltransferase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SOAT2
Synonyms (NCBI Gene) Gene synonyms aliases	ACACT2, ACAT2, ARGP2
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.	Summary:This gene is a member of a small family of acyl coenzyme A:cholesterol acyltransferases. The gene encodes a membrane-bound enzyme localized in the endoplasmic reticulum that produces intracellular cholesterol esters from long-chain fatty acyl CoA

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018756	hsa-miR-335-5p	Microarray	18185580
MIRT495529	hsa-miR-377-5p	PAR-CLIP	22291592
MIRT495528	hsa-miR-6086	PAR-CLIP	22291592
MIRT495529	hsa-miR-377-5p	PAR-CLIP	22291592
MIRT495528	hsa-miR-6086	PAR-CLIP	22291592
MIRT2112915	hsa-miR-3620	CLIP-seq
MIRT2112916	hsa-miR-383	CLIP-seq
MIRT2112917	hsa-miR-4663	CLIP-seq
MIRT2112918	hsa-miR-4677-3p	CLIP-seq
MIRT2112919	hsa-miR-4679	CLIP-seq
MIRT2112920	hsa-miR-4709-3p	CLIP-seq
MIRT2112921	hsa-miR-4728-3p	CLIP-seq
MIRT2112922	hsa-miR-4772-5p	CLIP-seq
MIRT2112923	hsa-miR-935	CLIP-seq
MIRT2335831	hsa-miR-520d-5p	CLIP-seq
MIRT2335832	hsa-miR-524-5p	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000062	Function	Fatty-acyl-CoA binding	IBA
GO:0000062	Function	Fatty-acyl-CoA binding	IDA	16647063
GO:0004772	Function	Sterol O-acyltransferase activity	IDA	11294643
GO:0004772	Function	Sterol O-acyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	15451793
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	12808042
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005903	Component	Brush border	IDA	14615411
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IBA
GO:0008203	Process	Cholesterol metabolic process	IDA	11294643, 16647063
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008374	Function	O-acyltransferase activity	IEA
GO:0010742	Process	Macrophage derived foam cell differentiation	TAS	14615411
GO:0010878	Process	Cholesterol storage	IEA
GO:0015485	Function	Cholesterol binding	IBA
GO:0015485	Function	Cholesterol binding	IDA	16647063
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016746	Function	Acyltransferase activity	TAS	9756920
GO:0030299	Process	Intestinal cholesterol absorption	IC	14615411
GO:0033344	Process	Cholesterol efflux	IBA
GO:0033344	Process	Cholesterol efflux	IMP	15308631
GO:0034379	Process	Very-low-density lipoprotein particle assembly	IMP	15308631
GO:0034383	Process	Low-density lipoprotein particle clearance	TAS
GO:0034736	Function	Cholesterol O-acyltransferase activity	IBA
GO:0034736	Function	Cholesterol O-acyltransferase activity	IDA	16647063
GO:0034736	Function	Cholesterol O-acyltransferase activity	IEA
GO:0034736	Function	Cholesterol O-acyltransferase activity	TAS
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	TAS	11401500

MIM	HGNC	e!Ensembl
601311	11178	ENSG00000167780

Protein

UniProt ID

O75908

Protein name

Sterol O-acyltransferase 2 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 2) (ACAT-2) (Cholesterol acyltransferase 2)

Protein function

Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol (PubMed:11294643, PubMed:16647063). Plays a role in lipoprotein assembly and dietary cholesterol absorption (PubMed:11294643). Utilize

PDB

7N6Q , 7N6R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03062	MBOAT	149 → 494	MBOAT, membrane-bound O-acyltransferase family	Family

Tissue specificity

TISSUE SPECIFICITY: Expression seems confined in hepatocytes and enterocytes. {ECO:0000269|PubMed:16331323}.

Sequence

MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQL
RELLDRAMREAIQSYPSQDKPLPPPPPGSLSRTQEPSLGKQKVFIIRKSLLDELMEVQHF
RTIYHMFIAGLCVFIISTLAIDFIDEGRLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLA
PYQALRLWARGTWTQATGLGCALLAAHAVVLCALPVHVAVEHQLPPASRCVLVFEQVRFL
MKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTLIYRETYPRTPYVRWNYVAKN
FAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFMLLLIFFAFLH
CWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG
VAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTM
LFLGQGIQVSLYCQEWYARRHCPLPQATFWGLVTPRSWSCHT

Sequence length

522

Interactions

View interactions

	KEGG		Reactome
	Steroid biosynthesis Cholesterol metabolism		LDL clearance

SOAT2 (sterol O-acyltransferase 2)