Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8435
Gene name Gene Name - the full gene name approved by the HGNC.	Sterol O-acyltransferase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SOAT2
Synonyms (NCBI Gene) Gene synonyms aliases	ACACT2, ACAT2, ARGP2
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.	Summary:This gene is a member of a small family of acyl coenzyme A:cholesterol acyltransferases. The gene encodes a membrane-bound enzyme localized in the endoplasmic reticulum that produces intracellular cholesterol esters from long-chain fatty acyl CoA

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018756	hsa-miR-335-5p	Microarray	18185580
MIRT495529	hsa-miR-377-5p	PAR-CLIP	22291592
MIRT495528	hsa-miR-6086	PAR-CLIP	22291592
MIRT495529	hsa-miR-377-5p	PAR-CLIP	22291592
MIRT495528	hsa-miR-6086	PAR-CLIP	22291592
MIRT2112915	hsa-miR-3620	CLIP-seq
MIRT2112916	hsa-miR-383	CLIP-seq
MIRT2112917	hsa-miR-4663	CLIP-seq
MIRT2112918	hsa-miR-4677-3p	CLIP-seq
MIRT2112919	hsa-miR-4679	CLIP-seq
MIRT2112920	hsa-miR-4709-3p	CLIP-seq
MIRT2112921	hsa-miR-4728-3p	CLIP-seq
MIRT2112922	hsa-miR-4772-5p	CLIP-seq
MIRT2112923	hsa-miR-935	CLIP-seq
MIRT2335831	hsa-miR-520d-5p	CLIP-seq
MIRT2335832	hsa-miR-524-5p	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000062	Function	Fatty-acyl-CoA binding	IBA	21873635
GO:0000062	Function	Fatty-acyl-CoA binding	IDA	16647063
GO:0004772	Function	Sterol O-acyltransferase activity	IDA	11294643
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	15451793
GO:0005789	Component	Endoplasmic reticulum membrane	IBA	21873635
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	12808042
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005903	Component	Brush border	IDA	14615411
GO:0008203	Process	Cholesterol metabolic process	IBA	21873635
GO:0008203	Process	Cholesterol metabolic process	IDA	11294643, 16647063
GO:0008374	Function	O-acyltransferase activity	IBA	21873635
GO:0010742	Process	Macrophage derived foam cell differentiation	TAS	14615411
GO:0015485	Function	Cholesterol binding	IBA	21873635
GO:0015485	Function	Cholesterol binding	IDA	16647063
GO:0016021	Component	Integral component of membrane	IEA
GO:0016746	Function	Transferase activity, transferring acyl groups	TAS	9756920
GO:0030299	Process	Intestinal cholesterol absorption	IC	14615411
GO:0033344	Process	Cholesterol efflux	IBA	21873635
GO:0033344	Process	Cholesterol efflux	IMP	15308631
GO:0034379	Process	Very-low-density lipoprotein particle assembly	IMP	15308631
GO:0034383	Process	Low-density lipoprotein particle clearance	TAS
GO:0034435	Process	Cholesterol esterification	IBA	21873635
GO:0034435	Process	Cholesterol esterification	IDA	11294643, 16647063
GO:0034736	Function	Cholesterol O-acyltransferase activity	IBA	21873635
GO:0034736	Function	Cholesterol O-acyltransferase activity	IDA	16647063
GO:0042632	Process	Cholesterol homeostasis	TAS	11401500

MIM	HGNC	e!Ensembl
601311	11178	ENSG00000167780

Protein

UniProt ID

O75908

Protein name

Sterol O-acyltransferase 2 (EC 2.3.1.26) (Acyl-coenzyme A:cholesterol acyltransferase 2) (ACAT-2) (Cholesterol acyltransferase 2)

Protein function

Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol (PubMed:11294643, PubMed:16647063). Plays a role in lipoprotein assembly and dietary cholesterol absorption (PubMed:11294643). Utilize

PDB

7N6Q , 7N6R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03062	MBOAT	149 → 494	MBOAT, membrane-bound O-acyltransferase family	Family

Tissue specificity

TISSUE SPECIFICITY: Expression seems confined in hepatocytes and enterocytes. {ECO:0000269|PubMed:16331323}.

Sequence

MEPGGARLRLQRTEGLGGERERQPCGDGNTETHRAPDLVQWTRHMEAVKAQLLEQAQGQL
RELLDRAMREAIQSYPSQDKPLPPPPPGSLSRTQEPSLGKQKVFIIRKSLLDELMEVQHF
RTIYHMFIAGLCVFIISTLAIDFIDEGRLLLEFDLLIFSFGQLPLALVTWVPMFLSTLLA
PYQALRLWARGTWTQATGLGCALLAAHAVVLCALPVHVAVEHQLPPASRCVLVFEQVRFL
MKSYSFLREAVPGTLRARRGEGIQAPSFSSYLYFLFCPTLIYRETYPRTPYVRWNYVAKN
FAQALGCVLYACFILGRLCVPVFANMSREPFSTRALVLSILHATLPGIFMLLLIFFAFLH
CWLNAFAEMLRFGDRMFYRDWWNSTSFSNYYRTWNVVVHDWLYSYVYQDGLRLLGARARG
VAMLGVFLVSAVAHEYIFCFVLGFFYPVMLILFLVIGGMLNFMMHDQRTGPAWNVLMWTM
LFLGQGIQVSLYCQEWYARRHCPLPQATFWGLVTPRSWSCHT

Sequence length

522

Interactions

View interactions

	KEGG		Reactome
	Steroid biosynthesis Cholesterol metabolism		LDL clearance

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Celiac disease	Celiac Disease		30097691	ClinVar

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Atherosclerosis	Associate	22243772
Breast Neoplasms	Associate	36694223
Carcinoma Hepatocellular	Associate	16274362
Coronary Artery Disease	Associate	30696703
Hyperlipidemias	Associate	12621162
Osteoporosis	Associate	39884015
Sarcopenia	Associate	32478482

SOAT2 (sterol O-acyltransferase 2)