Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84342
Gene name Gene Name - the full gene name approved by the HGNC.
Component of oligomeric golgi complex 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COG8
Synonyms (NCBI Gene) Gene synonyms aliases
CDG2H, DOR1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CDG2H
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modificatio
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs72795277 G>A Conflicting-interpretations-of-pathogenicity, likely-benign Synonymous variant, coding sequence variant
rs113642086 G>A Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance Synonymous variant, coding sequence variant
rs779899559 G>A,C Likely-pathogenic Coding sequence variant, stop gained, missense variant
rs890271209 A>C,G Likely-pathogenic Missense variant, stop gained, coding sequence variant
rs1597225261 C>A Likely-pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT045035 hsa-miR-186-5p CLASH 23622248
MIRT902324 hsa-miR-145 CLIP-seq
MIRT902325 hsa-miR-182 CLIP-seq
MIRT902326 hsa-miR-187 CLIP-seq
MIRT902327 hsa-miR-2110 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 25416956, 26871637, 32814053
GO:0005794 Component Golgi apparatus IDA
GO:0006888 Process Endoplasmic reticulum to Golgi vesicle-mediated transport TAS
GO:0006891 Process Intra-Golgi vesicle-mediated transport IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606979 18623 ENSG00000213380
Protein
UniProt ID Q96MW5
Protein name Conserved oligomeric Golgi complex subunit 8 (COG complex subunit 8) (Component of oligomeric Golgi complex 8)
Protein function Required for normal Golgi function.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04124 Dor1 50 388 Dor1-like family Family
Sequence
MATAATIPSVATATAAALGEVEDEGLLASLFRDRFPEAQWRERPDVGRYLRELSGSGLER
LRREPERLAEERAQLLQQTRDLAFANYKTFIRGAECTERIHRLFGDVEASLGRLLDRLPS
FQQSCRNFVKEAEEISSNRRMNSLTLNRHTEILEILEIPQLMDTCVRNSYYEEALELAAY
VRRLERKYSSIPVIQGIVNEVRQSMQLMLSQLIQQLRTNIQLPACLRVIGYLRRMDVFTE
AELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEASRVHLFDIITQYRAIFSDEDPLL
PPAMGEHTVNESAIFHGWVLQKVSQFLQVLETDLYRGIGGHLDSLLGQCMYFGLSFSRVG
ADFRGQLAPVFQRVAISTFQKAIQETVE
KFQEEMNSYMLISAPAILGTSNMPAAVPATQP
GTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFH
RAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNL
GHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGR
AETQAEPPSVGP
Sequence length 612
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    COPI-mediated anterograde transport
Intra-Golgi traffic
Retrograde transport at the Trans-Golgi-Network
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Congenital disorder of glycosylation Congenital Disorder Of Glycosylation, Type IIH, COG8-CDG rs121434387, rs1264383808, rs766244312, rs1555497568, rs1555496968, rs267606740, rs1568296260, rs1562937199, rs28939378, rs121908583, rs1568757730, rs28936415, rs587776874, rs387906831, rs151173406
View all (80 more)
27604308, 17331980, 11980916, 17220172
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Developmental regression Developmental regression rs1224421127
Encephalopathy Acute encephalopathy rs118204095, rs118204096, rs118204101, rs118204109, rs118204119, rs28939378, rs121908531, rs28936674, rs80359829, rs80359828, rs80359816, rs80359814, rs2124448824, rs121909739, rs121909740
View all (107 more)
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 26045774
Carcinoma Non Small Cell Lung Associate 26045774
Carcinoma Renal Cell Associate 26045774, 34539936
Colorectal Neoplasms Associate 26045774
Congenital Disorder Of Glycosylation Type In Associate 37083278
Congenital Disorders of Glycosylation Associate 37083278
Esophageal Neoplasms Associate 26045774
Multiple Organ Failure Associate 19690088
Nervous System Diseases Associate 19690088
Stomach Neoplasms Associate 26045774