Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84335
Gene name	AKT1 substrate 1
Gene symbol	AKT1S1
Synonyms (NCBI Gene)	LobePRAS40
Chromosome	19
Chromosome location	19q13.33
Summary	AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008]

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022786	hsa-miR-124-3p	Microarray	18668037
MIRT045373	hsa-miR-185-5p	CLASH	23622248
MIRT041919	hsa-miR-484	CLASH	23622248
MIRT441240	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT441240	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT776479	hsa-miR-1234	CLIP-seq
MIRT776480	hsa-miR-129-3p	CLIP-seq
MIRT776481	hsa-miR-1307	CLIP-seq
MIRT776482	hsa-miR-1469	CLIP-seq
MIRT776483	hsa-miR-146a	CLIP-seq
MIRT776484	hsa-miR-146b-5p	CLIP-seq
MIRT776485	hsa-miR-1908	CLIP-seq
MIRT776486	hsa-miR-3135b	CLIP-seq
MIRT776487	hsa-miR-3668	CLIP-seq
MIRT776488	hsa-miR-3689a-3p	CLIP-seq
MIRT776489	hsa-miR-3689c	CLIP-seq
MIRT776490	hsa-miR-4268	CLIP-seq
MIRT776491	hsa-miR-4330	CLIP-seq
MIRT776492	hsa-miR-4419a	CLIP-seq
MIRT776493	hsa-miR-4463	CLIP-seq
MIRT776494	hsa-miR-4479	CLIP-seq
MIRT776495	hsa-miR-4510	CLIP-seq
MIRT776496	hsa-miR-4524	CLIP-seq
MIRT776497	hsa-miR-4690-5p	CLIP-seq
MIRT776498	hsa-miR-4728-5p	CLIP-seq
MIRT776499	hsa-miR-4732-5p	CLIP-seq
MIRT776500	hsa-miR-4736	CLIP-seq
MIRT776501	hsa-miR-663	CLIP-seq
MIRT776479	hsa-miR-1234	CLIP-seq
MIRT776502	hsa-miR-125a-5p	CLIP-seq
MIRT776503	hsa-miR-125b	CLIP-seq
MIRT776480	hsa-miR-129-3p	CLIP-seq
MIRT776483	hsa-miR-146a	CLIP-seq
MIRT776484	hsa-miR-146b-5p	CLIP-seq
MIRT776504	hsa-miR-3184	CLIP-seq
MIRT776505	hsa-miR-3664-3p	CLIP-seq
MIRT776487	hsa-miR-3668	CLIP-seq
MIRT776488	hsa-miR-3689a-3p	CLIP-seq
MIRT776489	hsa-miR-3689c	CLIP-seq
MIRT776506	hsa-miR-382	CLIP-seq
MIRT776507	hsa-miR-423-5p	CLIP-seq
MIRT776508	hsa-miR-4270	CLIP-seq
MIRT776509	hsa-miR-4280	CLIP-seq
MIRT776510	hsa-miR-4319	CLIP-seq
MIRT776491	hsa-miR-4330	CLIP-seq
MIRT776492	hsa-miR-4419a	CLIP-seq
MIRT776511	hsa-miR-4441	CLIP-seq
MIRT776493	hsa-miR-4463	CLIP-seq
MIRT776512	hsa-miR-4481	CLIP-seq
MIRT776495	hsa-miR-4510	CLIP-seq
MIRT776496	hsa-miR-4524	CLIP-seq
MIRT776513	hsa-miR-4529-5p	CLIP-seq
MIRT776514	hsa-miR-4534	CLIP-seq
MIRT776497	hsa-miR-4690-5p	CLIP-seq
MIRT776498	hsa-miR-4728-5p	CLIP-seq
MIRT776515	hsa-miR-4732-3p	CLIP-seq
MIRT776499	hsa-miR-4732-5p	CLIP-seq
MIRT776516	hsa-miR-4745-5p	CLIP-seq
MIRT776517	hsa-miR-510	CLIP-seq
MIRT776518	hsa-miR-544b	CLIP-seq
MIRT776519	hsa-miR-605	CLIP-seq
MIRT776520	hsa-miR-670	CLIP-seq
MIRT776521	hsa-miR-873	CLIP-seq
MIRT1929232	hsa-miR-216a	CLIP-seq
MIRT1929233	hsa-miR-216b	CLIP-seq
MIRT1929234	hsa-miR-3158-3p	CLIP-seq
MIRT1929235	hsa-miR-3187-3p	CLIP-seq
MIRT1929236	hsa-miR-3192	CLIP-seq
MIRT1929237	hsa-miR-361-3p	CLIP-seq
MIRT1929238	hsa-miR-4314	CLIP-seq
MIRT776491	hsa-miR-4330	CLIP-seq
MIRT1929239	hsa-miR-4435	CLIP-seq
MIRT1929240	hsa-miR-4646-5p	CLIP-seq
MIRT1929241	hsa-miR-4701-5p	CLIP-seq
MIRT1929242	hsa-miR-4721	CLIP-seq
MIRT1929243	hsa-miR-4747-5p	CLIP-seq
MIRT1929244	hsa-miR-4779	CLIP-seq
MIRT1929245	hsa-miR-548s	CLIP-seq
MIRT1929246	hsa-miR-588	CLIP-seq
MIRT2169827	hsa-miR-188-5p	CLIP-seq
MIRT776519	hsa-miR-605	CLIP-seq
MIRT1929232	hsa-miR-216a	CLIP-seq
MIRT1929233	hsa-miR-216b	CLIP-seq
MIRT776491	hsa-miR-4330	CLIP-seq
MIRT2169828	hsa-miR-548a-3p	CLIP-seq
MIRT2169829	hsa-miR-548e	CLIP-seq
MIRT2169830	hsa-miR-548f	CLIP-seq
MIRT2435295	hsa-miR-1252	CLIP-seq
MIRT2169827	hsa-miR-188-5p	CLIP-seq
MIRT2435296	hsa-miR-3154	CLIP-seq
MIRT2435297	hsa-miR-633	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0004860	Function	Protein kinase inhibitor activity	IDA	18372248
GO:0005515	Function	Protein binding	IPI	12524439, 15161933, 17386266, 17604271, 17979178, 18372248, 19648646, 24255178, 28514442, 33961781, 35271311, 36931259
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	17386266
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	17386266, 17510057, 29236692
GO:0031669	Process	Cellular response to nutrient levels	IDA	29750193
GO:0031931	Component	TORC1 complex	IDA	17386266, 31601764
GO:0032007	Process	Negative regulation of TOR signaling	IDA	17386266
GO:0032007	Process	Negative regulation of TOR signaling	IEA
GO:0038202	Process	TORC1 signaling	IDA	12087098, 29750193
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	IEA
GO:0043523	Process	Regulation of neuron apoptotic process	ISS
GO:0045792	Process	Negative regulation of cell size	IDA	17386266
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IBA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	17386266, 17510057, 18372248, 29236692

MIM	HGNC	e!Ensembl
610221	28426	ENSG00000204673

Q96B36

Protein name

Proline-rich AKT1 substrate 1 (40 kDa proline-rich AKT substrate)

Protein function

Negative regulator of the mechanistic target of rapamycin complex 1 (mTORC1), an evolutionarily conserved central nutrient sensor that stimulates anabolic reactions and macromolecule biosynthesis to promote cellular biomass generation and growth

PDB

5WBL , 5WBU , 5WBY , 6SB0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15798	PRAS	127 → 251	Proline-rich AKT1 substrate 1	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels of expression in liver and heart. Expressed at higher levels in cancer cell lines (e.g. A-549 and HeLa) than in normal cell lines (e.g. HEK293). {ECO:0000269|PubMed:12524439, ECO:0000269|PubMed:1617

Sequence

MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARR
CLHDIALAHRAATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQL
GISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY
AKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLP
RPRLNTSDFQKLKRKY

Sequence length

256

Interactions

View interactions

	KEGG		Reactome
	Autophagy - animal mTOR signaling pathway AMPK signaling pathway Longevity regulating pathway Longevity regulating pathway - multiple species Thermogenesis Shigellosis		mTOR signalling mTORC1-mediated signalling AKT phosphorylates targets in the cytosol HSF1-dependent transactivation Constitutive Signaling by AKT1 E17K in Cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	22873724, 23159938	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Associate	36894313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	24704832	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	35140327	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	28050343	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	25714871, 35635239	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	36894313	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	35287169	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Associate	22879939	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	28050343	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	21886838, 27226530	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	28936799, 35287169	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	29236692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	23029019	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	35088088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	31210839	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	34948236	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	35164771	★★★★★ ★☆☆☆☆ Found in Text Mining only

AKT1S1 (AKT1 substrate 1)