PRXL2A (peroxiredoxin like 2A)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84293
Gene name Gene Name - the full gene name approved by the HGNC.
Peroxiredoxin like 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRXL2A
Synonyms (NCBI Gene) Gene synonyms aliases
Adrx, C10orf58, FAM213A, PAMM
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q23.1
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 19951071
GO:0005737 Component Cytoplasm IEA
GO:0016209 Function Antioxidant activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617165 28651 ENSG00000122378
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9BRX8
Protein name Peroxiredoxin-like 2A (Peroxiredoxin-like 2 activated in M-CSF stimulated monocytes) (Protein PAMM) (Redox-regulatory protein FAM213A)
Protein function Involved in redox regulation of the cell (PubMed:19951071, PubMed:26438880). Acts as an antioxidant (PubMed:19951071, PubMed:26438880). Inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation (PubMed:19951071). May affec
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13911 AhpC-TSA_2 94 → 202 AhpC/TSA antioxidant enzyme Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in CSF1 and TNFSF11-stimulated CD14(+) peripheral blood mononuclear cells (PBMCs). {ECO:0000269|PubMed:19951071}.
Sequence 
MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKE
PRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTE
VKDFQPYFKGEIFLDEKKKFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFI
LGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEKK
Sequence length 229
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Borderline personality disorder Borderline personality disorder N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Oral Ulcer Associate 37369724