Gene Gene information from NCBI Gene database.
Entrez ID 84288
Gene name Dynein regulatory complex subunit 8
Gene symbol DRC8
Synonyms (NCBI Gene)
CFAP200EFCAB2
Chromosome 1
Chromosome location 1q44
miRNA miRNA information provided by mirtarbase database.
497
miRTarBase ID miRNA Experiments Reference
MIRT607856 hsa-miR-431-5p HITS-CLIP 23824327
MIRT607855 hsa-miR-4711-3p HITS-CLIP 23824327
MIRT607854 hsa-miR-6867-5p HITS-CLIP 23824327
MIRT607853 hsa-miR-574-5p HITS-CLIP 23824327
MIRT607856 hsa-miR-431-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005929 Component Cilium IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619617 28166 ENSG00000203666
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5VUJ9
Protein name Dynein regulatory complex protein 8 (EF-hand calcium-binding domain-containing protein 2)
Protein function Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. {ECO:0000250|UniProtK
PDB 8J07
Family and domains
Sequence
MLGPGQVRLRPRVWRDKAGGRVADGASGLPPARGSWRETGTGRALGASSPPRPAQGSSSP
GIQSGPSSRPGSPRGAEQAGTPRPRLSLGISQATGSAARWRTRRTGKGLGYNSDEIRPRT
LLIEHLMEGGRRDHHTMTVLWGTQEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIR
SLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVL
DSAKRGFLTKDELIKYMTEEDGVSLRRPG
Sequence length 269
Interactions View interactions