Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84276
Gene name Gene Name - the full gene name approved by the HGNC.
Nicolin 1, tubulin polyglutamylase complex subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NICN1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This protein encoded by this gene localizes to the nucleus and is expressed in numerous tissues including brain, testis, liver, and kidney. This refseq contains genomic sequence in its 3` UTR which is not supported by experimental evidence. Computer predi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051677 hsa-let-7e-5p CLASH 23622248
MIRT670823 hsa-miR-4753-5p HITS-CLIP 23824327
MIRT670822 hsa-miR-383-3p HITS-CLIP 23824327
MIRT670820 hsa-miR-6499-5p HITS-CLIP 23824327
MIRT670821 hsa-miR-4493 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
GO:0005654 Component Nucleoplasm IDA
GO:0005874 Component Microtubule IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611516 18317 ENSG00000145029
Protein
UniProt ID Q9BSH3
Protein name Nicolin-1 (NPCEDRG) (Tubulin polyglutamylase complex subunit 5) (PGs5)
Family and domains
Tissue specificity TISSUE SPECIFICITY: High expression level is found in brain, testis, liver and kidney. Weak expression in spleen, leukocytes, small intestine and colon. {ECO:0000269|PubMed:12392556}.
Sequence
MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSI
RVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQ
PSPLWLSFTVEELQIYQQGPKSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQM
WALTEMIRASHTSARIGRFDVDGCYDLNLLSYT
Sequence length 213
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Glioma Glioma N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG) N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS