Gene Gene information from NCBI Gene database.
Entrez ID 84276
Gene name Nicolin 1, tubulin polyglutamylase complex subunit
Gene symbol NICN1
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3p21.31
Summary This protein encoded by this gene localizes to the nucleus and is expressed in numerous tissues including brain, testis, liver, and kidney. This refseq contains genomic sequence in its 3` UTR which is not supported by experimental evidence. Computer predi
miRNA miRNA information provided by mirtarbase database.
493
miRTarBase ID miRNA Experiments Reference
MIRT051677 hsa-let-7e-5p CLASH 23622248
MIRT670823 hsa-miR-4753-5p HITS-CLIP 23824327
MIRT670822 hsa-miR-383-3p HITS-CLIP 23824327
MIRT670820 hsa-miR-6499-5p HITS-CLIP 23824327
MIRT670821 hsa-miR-4493 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
GO:0005654 Component Nucleoplasm IDA
GO:0005874 Component Microtubule IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611516 18317 ENSG00000145029
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BSH3
Protein name Nicolin-1 (NPCEDRG) (Tubulin polyglutamylase complex subunit 5) (PGs5)
Family and domains
Tissue specificity TISSUE SPECIFICITY: High expression level is found in brain, testis, liver and kidney. Weak expression in spleen, leukocytes, small intestine and colon. {ECO:0000269|PubMed:12392556}.
Sequence
MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSI
RVRQYTSAHTPAKWVTCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQ
PSPLWLSFTVEELQIYQQGPKSPSVTFPKWLSHPVPCEQPALLREGLPDPSRVSSEVQQM
WALTEMIRASHTSARIGRFDVDGCYDLNLLSYT
Sequence length 213
Interactions View interactions