Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84260
Gene name Gene Name - the full gene name approved by the HGNC.	Trichoplein keratin filament binding
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TCHP
Synonyms (NCBI Gene) Gene synonyms aliases	TpMs
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.11

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024401	hsa-miR-215-5p	Microarray	19074876
MIRT026122	hsa-miR-192-5p	Microarray	19074876
MIRT049541	hsa-miR-92a-3p	CLASH	23622248
MIRT042371	hsa-miR-484	CLASH	23622248
MIRT643997	hsa-miR-4438	HITS-CLIP	23824327
MIRT643996	hsa-miR-4742-5p	HITS-CLIP	23824327
MIRT643995	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT643994	hsa-miR-5095	HITS-CLIP	23824327
MIRT643993	hsa-miR-3149	HITS-CLIP	23824327
MIRT643997	hsa-miR-4438	HITS-CLIP	23824327
MIRT643996	hsa-miR-4742-5p	HITS-CLIP	23824327
MIRT643995	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT643994	hsa-miR-5095	HITS-CLIP	23824327
MIRT643993	hsa-miR-3149	HITS-CLIP	23824327
MIRT739200	hsa-miR-1269	CLIP-seq
MIRT739201	hsa-miR-1269b	CLIP-seq
MIRT1416605	hsa-miR-3199	CLIP-seq
MIRT1416606	hsa-miR-4269	CLIP-seq
MIRT1416607	hsa-miR-4468	CLIP-seq
MIRT739199	hsa-miR-4529-3p	CLIP-seq
MIRT1416608	hsa-miR-4532	CLIP-seq
MIRT1416609	hsa-miR-4663	CLIP-seq
MIRT1416610	hsa-miR-4690-5p	CLIP-seq
MIRT739202	hsa-miR-4726-3p	CLIP-seq
MIRT2124925	hsa-miR-3130-3p	CLIP-seq
MIRT2124926	hsa-miR-767-5p	CLIP-seq
MIRT2347350	hsa-miR-1343	CLIP-seq
MIRT2347351	hsa-miR-3180-5p	CLIP-seq
MIRT2347352	hsa-miR-3190	CLIP-seq
MIRT1416605	hsa-miR-3199	CLIP-seq
MIRT2347353	hsa-miR-4277	CLIP-seq
MIRT2347354	hsa-miR-4432	CLIP-seq
MIRT2347355	hsa-miR-4484	CLIP-seq
MIRT2347356	hsa-miR-4509	CLIP-seq
MIRT2347357	hsa-miR-4659a-3p	CLIP-seq
MIRT2347358	hsa-miR-4659b-3p	CLIP-seq
MIRT2347359	hsa-miR-488	CLIP-seq
MIRT2347360	hsa-miR-520a-5p	CLIP-seq
MIRT2347361	hsa-miR-525-5p	CLIP-seq
MIRT2347362	hsa-miR-548an	CLIP-seq
MIRT2347363	hsa-miR-548m	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15731013, 16189514, 25270598, 25416956, 26638075, 27173435, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IDA	18931701
GO:0005739	Component	Mitochondrion	IDA	18931701
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	18931701
GO:0006915	Process	Apoptotic process	IBA	21873635
GO:0006915	Process	Apoptotic process	IDA	18931701
GO:0030030	Process	Cell projection organization	IEA
GO:0030057	Component	Desmosome	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	18931701
GO:0045095	Component	Keratin filament	IBA	21873635
GO:0045095	Component	Keratin filament	IDA	15731013
GO:0045179	Component	Apical cortex	IDA	15731013
GO:1902018	Process	Negative regulation of cilium assembly	IMP	25270598

MIM	HGNC	e!Ensembl
612654	28135	ENSG00000139437

Protein

UniProt ID

Q9BT92

Protein name

Trichoplein keratin filament-binding protein (Protein TCHP) (Mitochondrial protein with oncostatic activity) (Mitostatin) (Tumor suppressor protein)

Protein function

Tumor suppressor which has the ability to inhibit cell growth and be pro-apoptotic during cell stress. Inhibits cell growth in bladder and prostate cancer cells by a down-regulation of HSPB1 by inhibiting its phosphorylation. May act as a 'cappi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13868	TPH	143 → 488	Trichohyalin-plectin-homology domain	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in normal urothelial and breast epithelial cells. Also expressed in the smooth muscle and endothelial cells. Reduced expression seen in advanced bladder and breast carcinomas (at protein level). Ubiquitous. Exp

Sequence

MALPTLPSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSY
QRSMHAYQREKMKEEKRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQH
GKLKSAKEEQRKLIAEQLLYEHWKKNNPKLREMELDLHQKHVVNSWEMQKEEKKQQEATA
EQENKRYENEYERARREALERMKAEEERRQLEDKLQAEALLQQMEELKLKEVEATKLKKE
QENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRIL
QALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLLREEAKEMWEK
REAEWARERSARDRLMSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELAR
REKEESEKLKSARKQELEAQVAERRLQAWEADQQEEEEEEEARRVEQLSDALLQQEAETM
AEQGYRPKPYGHPKIAWN

Sequence length

498

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome	GWAS
Myocardial Infarction	Myocardial Infarction	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	24403067
Dyslipidemias	Associate	29879492
Hypoalphalipoproteinemias	Associate	29879492
Keratoconus	Associate	36811882
Mitochondrial Diseases	Associate	29921586
Myocardial Infarction	Associate	30226566
Neoplasms	Associate	24403067
Neoplasms	Inhibit	29921586

TCHP (trichoplein keratin filament binding)