Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84152
Gene name Gene Name - the full gene name approved by the HGNC.	Protein phosphatase 1 regulatory inhibitor subunit 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PPP1R1B
Synonyms (NCBI Gene) Gene synonyms aliases	DARPP-32, DARPP32
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeu

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT733522	hsa-miR-7844-5p	Luciferase reporter assay, RNA-seq, qRT-PCR	33189894
MIRT1256355	hsa-miR-1275	CLIP-seq
MIRT1256356	hsa-miR-4525	CLIP-seq
MIRT1256357	hsa-miR-4665-5p	CLIP-seq
MIRT1256358	hsa-miR-4723-5p	CLIP-seq
MIRT1256359	hsa-miR-490-3p	CLIP-seq
MIRT1256360	hsa-miR-566	CLIP-seq
MIRT1256361	hsa-miR-625	CLIP-seq
MIRT1256362	hsa-miR-637	CLIP-seq
MIRT1256363	hsa-miR-1343	CLIP-seq
MIRT1256364	hsa-miR-330-3p	CLIP-seq
MIRT1256365	hsa-miR-4642	CLIP-seq
MIRT1256366	hsa-miR-4720-5p	CLIP-seq
MIRT1256367	hsa-miR-4799-3p	CLIP-seq
MIRT2302161	hsa-miR-1182	CLIP-seq
MIRT2302162	hsa-miR-146b-3p	CLIP-seq
MIRT2302163	hsa-miR-193a-5p	CLIP-seq
MIRT2302164	hsa-miR-3173-5p	CLIP-seq
MIRT2302165	hsa-miR-3945	CLIP-seq
MIRT2302166	hsa-miR-4253	CLIP-seq
MIRT2302167	hsa-miR-4269	CLIP-seq
MIRT2302168	hsa-miR-4514	CLIP-seq
MIRT2302169	hsa-miR-4692	CLIP-seq
MIRT2302170	hsa-miR-4711-5p	CLIP-seq
MIRT2302171	hsa-miR-4722-3p	CLIP-seq
MIRT2302172	hsa-miR-4742-5p	CLIP-seq
MIRT2302173	hsa-miR-541	CLIP-seq
MIRT2302174	hsa-miR-654-5p	CLIP-seq
MIRT2302175	hsa-miR-874	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0004860	Function	Protein kinase inhibitor activity	TAS	10604473
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	TAS
GO:0004864	Function	Protein phosphatase inhibitor activity	IDA	10807923
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0004864	Function	Protein phosphatase inhibitor activity	TAS	10604473
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10604473
GO:0007621	Process	Negative regulation of female receptivity	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008542	Process	Visual learning	IEA
GO:0019888	Function	Protein phosphatase regulator activity	TAS
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0071314	Process	Cellular response to cocaine	IEA

MIM	HGNC	e!Ensembl
604399	9287	ENSG00000131771

Protein

UniProt ID

Q9UD71

Protein name

Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)

Protein function

Inhibitor of protein-phosphatase 1.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05395	DARPP-32	2 → 181	Protein phosphatase inhibitor 1/DARPP-32	Family

Sequence

MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGE
GHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREE
DEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSED
QVEDPALSEPGEEPQRPSPSEPGT

Sequence length

204

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Dopaminergic synapse Cocaine addiction Amphetamine addiction Alcoholism		DARPP-32 events

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma (childhood onset)	N/A	N/A	GWAS
Dyslexia	Dyslexia	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	14508844, 16849520
Adenocarcinoma Of Esophagus	Associate	16849520
Attention Deficit Disorder with Hyperactivity	Associate	31896117
Autism Spectrum Disorder	Associate	22559203
Autistic Disorder	Associate	22559203
Breast Neoplasms	Inhibit	19593441
Breast Neoplasms	Associate	20836878, 29180608, 31740718, 33991172, 34224831, 37626402, 38036593
Carcinogenesis	Associate	14508844, 15188007, 25779598
Carcinogenesis	Stimulate	22589394
Carcinoma Squamous Cell	Inhibit	17695523
Colorectal Neoplasms	Associate	25692420
Esophageal Squamous Cell Carcinoma	Associate	15188007
Glioblastoma	Associate	23250732
Huntington Disease	Associate	25275533, 31447328, 40336225
Hypokinesia	Associate	22615781
Leukoplakia Oral	Inhibit	17695523
Mouth Diseases	Inhibit	17695523
Neoplasm Metastasis	Stimulate	25692420
Neoplasms	Associate	14508844, 15188007, 17695523, 31740718
Neoplasms	Stimulate	16849520, 25779598
Obesity	Associate	31896117
Oculocutaneous albinism type 2	Stimulate	23250732
Ovarian Neoplasms	Associate	32588513
Pain	Associate	30639570
Pain Postoperative	Associate	30639570
Prostatitis	Stimulate	14508844
Retinal Dysplasia	Associate	15188007
Retinal Dysplasia	Inhibit	17695523
Squamous Cell Carcinoma of Head and Neck	Inhibit	17695523
Stomach Neoplasms	Associate	14508844, 22589394, 25779598
Stomach Neoplasms	Stimulate	15188007

PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B)