PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B)

Gene

• Entrez ID: 84152
• Gene name: Protein phosphatase 1 regulatory inhibitor subunit 1B
• Gene symbol: PPP1R1B
• Synonyms (NCBI Gene): DARPP-32, DARPP32
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT733522	hsa-miR-7844-5p	Luciferase reporter assay, RNA-seq, qRT-PCR	33189894
MIRT1256355	hsa-miR-1275	CLIP-seq
MIRT1256356	hsa-miR-4525	CLIP-seq
MIRT1256357	hsa-miR-4665-5p	CLIP-seq
MIRT1256358	hsa-miR-4723-5p	CLIP-seq
MIRT1256359	hsa-miR-490-3p	CLIP-seq
MIRT1256360	hsa-miR-566	CLIP-seq
MIRT1256361	hsa-miR-625	CLIP-seq
MIRT1256362	hsa-miR-637	CLIP-seq
MIRT1256363	hsa-miR-1343	CLIP-seq
MIRT1256364	hsa-miR-330-3p	CLIP-seq
MIRT1256365	hsa-miR-4642	CLIP-seq
MIRT1256366	hsa-miR-4720-5p	CLIP-seq
MIRT1256367	hsa-miR-4799-3p	CLIP-seq
MIRT2302161	hsa-miR-1182	CLIP-seq
MIRT2302162	hsa-miR-146b-3p	CLIP-seq
MIRT2302163	hsa-miR-193a-5p	CLIP-seq
MIRT2302164	hsa-miR-3173-5p	CLIP-seq
MIRT2302165	hsa-miR-3945	CLIP-seq
MIRT2302166	hsa-miR-4253	CLIP-seq
MIRT2302167	hsa-miR-4269	CLIP-seq
MIRT2302168	hsa-miR-4514	CLIP-seq
MIRT2302169	hsa-miR-4692	CLIP-seq
MIRT2302170	hsa-miR-4711-5p	CLIP-seq
MIRT2302171	hsa-miR-4722-3p	CLIP-seq
MIRT2302172	hsa-miR-4742-5p	CLIP-seq
MIRT2302173	hsa-miR-541	CLIP-seq
MIRT2302174	hsa-miR-654-5p	CLIP-seq
MIRT2302175	hsa-miR-874	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0004860	Function	Protein kinase inhibitor activity	TAS	10604473
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	TAS
GO:0004864	Function	Protein phosphatase inhibitor activity	IDA	10807923
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0004864	Function	Protein phosphatase inhibitor activity	TAS	10604473
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10604473
GO:0007621	Process	Negative regulation of female receptivity	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008542	Process	Visual learning	IEA
GO:0019888	Function	Protein phosphatase regulator activity	TAS
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0071314	Process	Cellular response to cocaine	IEA

Other IDs

• MIM: 604399
• HGNC: 9287
• e!Ensembl: ENSG00000131771

Protein

• UniProt ID: Q9UD71
• Protein name: Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)
• Protein function: Inhibitor of protein-phosphatase 1.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05395	DARPP-32	2 → 181	Protein phosphatase inhibitor 1/DARPP-32	Family

• Sequence:

  MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGE
  GHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREE
  DEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSED
  QVEDPALSEPGEEPQRPSPSEPGT

• Sequence length: 204

Pathways

KEGG:

cAMP signaling pathway
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism

Reactome:

DARPP-32 events