Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84140
Gene name Gene Name - the full gene name approved by the HGNC.
FAM161 centrosomal protein A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FAM161A
Synonyms (NCBI Gene) Gene synonyms aliases
RP28
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p15
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the FAM161 family. It is expressed mainly in the retina. Mouse studies suggested that this gene is involved in development of retinal progenitors during embryogenesis, and that its activity is restricted to mature photoreceptors after
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs4672457 A>G,T Likely-pathogenic, benign Synonymous variant, coding sequence variant, non coding transcript variant, stop gained
rs138464813 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Genic downstream transcript variant, coding sequence variant, synonymous variant, non coding transcript variant, intron variant
rs139266382 G>C Conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, missense variant
rs140622968 C>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs187695569 A>C Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT981438 hsa-miR-1206 CLIP-seq
MIRT981439 hsa-miR-122 CLIP-seq
MIRT981440 hsa-miR-1234 CLIP-seq
MIRT981441 hsa-miR-1307 CLIP-seq
MIRT981442 hsa-miR-1343 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000235 Component Astral microtubule IDA 22791751
GO:0001917 Component Photoreceptor inner segment IDA 22791751
GO:0005515 Function Protein binding IPI 22791751, 22940612, 25018096, 25416956, 26638075, 27107012, 29892012, 31515488, 32296183, 32814053, 33961781, 36233334
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613596 25808 ENSG00000170264
Protein
UniProt ID Q3B820
Protein name Protein FAM161A
Protein function Involved in ciliogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10595 UPF0564 234 592 Uncharacterised protein family UPF0564 Family
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 3 are widely expressed with highest levels in retina and testis, with isoform 1 being the most abundant in all tissues tested. {ECO:0000269|PubMed:20705278, ECO:0000269|PubMed:20705279, ECO:0000269|PubMed:36233334
Sequence
MATSHRVAKLVASSLQTPVNPITGARVAQYEREDPLKALAAAEAILEDEEEEKVAQPAGA
SADLNTSFSGVDEHAPISYEDFVNFPDIHHSNEEYFKKVEELKAAHIETMAKLEKMYQDK
LHLKEVQPVVIREDSLSDSSRSVSEKNSYHPVSLMTSFSEPDLGQSSSLYVSSSEEELPN
LEKEYPRKNRMMTYAKELINNMWTDFCVEDYIRCKDTGFHAAEKRRKKRKEWVPTITVPE
PFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEYKKKFRANPVPASVFLPLYHDLV
KQKEERRRSLKEKSKEALLASQKPFKFIAREEQKRAAREKQLRDFLKYKKKTNRFKARPI
PRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKC
KHKVRCPTPDFEDLPERYQKHLSEHKSPKLLTVCKPFDLHASPHASIKREKILADIEADE
ENLKETRWPYLSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMREYQR
ELEEREEKLKKRPLLFERVAQKNARMAAEKHYSNTLKALGISDEFVSKKGQS
GKVLEYFN
NQETKSVTEDKESFNEEEKIEERENGEENYFIDTNSQDSYKEKDEANEESEEEKSVEESH
Sequence length 660
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
retinal dystrophy Retinal dystrophy rs200691042, rs1167380267, rs767414973, rs397704718, rs202193201, rs267606794, rs761440783 N/A
Retinitis Pigmentosa retinitis pigmentosa 28, retinitis pigmentosa, Autosomal recessive retinitis pigmentosa rs748847284, rs1673040470, rs4672457, rs200691042, rs767414973, rs397704718, rs1178184685, rs1553354861, rs1281095503, rs202193201, rs1572875669, rs267606794, rs777678022, rs1316281505, rs267606793
View all (4 more)
N/A
cone-rod dystrophy Cone-rod dystrophy rs200691042 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cone Rod Dystrophies Associate 29555955, 34130719
Genetic Diseases Inborn Associate 33494994
Hypertensive Retinopathy Associate 26113502
Infertility Male Associate 36896575
Muscular Disorders Atrophic Associate 24520187
Myopia Associate 32938956
Neoplastic Syndromes Hereditary Associate 24651477
Night Blindness Associate 24520187, 32938956
Photophobia Associate 24520187
Refsum Disease Infantile Associate 34130719