Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84108
Gene name	Polycomb group ring finger 6
Gene symbol	PCGF6
Synonyms (NCBI Gene)	MBLRRNF134
Chromosome	10
Chromosome location	10q24.33
Summary	The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This

Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030560	hsa-miR-24-3p	Microarray	19748357
MIRT497607	hsa-miR-6776-3p	PAR-CLIP	22291592
MIRT497606	hsa-miR-4733-5p	PAR-CLIP	22291592
MIRT497605	hsa-miR-203a-3p	PAR-CLIP	22291592
MIRT497607	hsa-miR-6776-3p	PAR-CLIP	22291592
MIRT497606	hsa-miR-4733-5p	PAR-CLIP	22291592
MIRT497605	hsa-miR-203a-3p	PAR-CLIP	22291592
MIRT1217709	hsa-miR-25	CLIP-seq
MIRT1217710	hsa-miR-3140-3p	CLIP-seq
MIRT1217711	hsa-miR-32	CLIP-seq
MIRT1217712	hsa-miR-363	CLIP-seq
MIRT1217713	hsa-miR-367	CLIP-seq
MIRT1217714	hsa-miR-3682-5p	CLIP-seq
MIRT1217715	hsa-miR-3942-3p	CLIP-seq
MIRT1217716	hsa-miR-3942-5p	CLIP-seq
MIRT1217717	hsa-miR-4275	CLIP-seq
MIRT1217718	hsa-miR-4426	CLIP-seq
MIRT1217719	hsa-miR-4647	CLIP-seq
MIRT1217720	hsa-miR-4662b	CLIP-seq
MIRT1217721	hsa-miR-4668-3p	CLIP-seq
MIRT1217722	hsa-miR-4678	CLIP-seq
MIRT1217723	hsa-miR-4703-5p	CLIP-seq
MIRT1217724	hsa-miR-4708-3p	CLIP-seq
MIRT1217725	hsa-miR-4747-5p	CLIP-seq
MIRT1217726	hsa-miR-4761-5p	CLIP-seq
MIRT1217727	hsa-miR-548p	CLIP-seq
MIRT1217728	hsa-miR-556-3p	CLIP-seq
MIRT1217729	hsa-miR-604	CLIP-seq
MIRT1217730	hsa-miR-647	CLIP-seq
MIRT1217731	hsa-miR-92a	CLIP-seq
MIRT1217732	hsa-miR-92b	CLIP-seq
MIRT2062947	hsa-miR-1264	CLIP-seq
MIRT1217709	hsa-miR-25	CLIP-seq
MIRT2062948	hsa-miR-3121-5p	CLIP-seq
MIRT1217711	hsa-miR-32	CLIP-seq
MIRT1217712	hsa-miR-363	CLIP-seq
MIRT1217713	hsa-miR-367	CLIP-seq
MIRT1217716	hsa-miR-3942-5p	CLIP-seq
MIRT1217723	hsa-miR-4703-5p	CLIP-seq
MIRT1217724	hsa-miR-4708-3p	CLIP-seq
MIRT1217731	hsa-miR-92a	CLIP-seq
MIRT1217732	hsa-miR-92b	CLIP-seq
MIRT2588876	hsa-miR-1236	CLIP-seq
MIRT2062947	hsa-miR-1264	CLIP-seq
MIRT2588877	hsa-miR-137	CLIP-seq
MIRT2588878	hsa-miR-183	CLIP-seq
MIRT1217709	hsa-miR-25	CLIP-seq
MIRT2588879	hsa-miR-3171	CLIP-seq
MIRT2588880	hsa-miR-3185	CLIP-seq
MIRT1217711	hsa-miR-32	CLIP-seq
MIRT1217712	hsa-miR-363	CLIP-seq
MIRT1217713	hsa-miR-367	CLIP-seq
MIRT2588881	hsa-miR-412	CLIP-seq
MIRT2588882	hsa-miR-4709-3p	CLIP-seq
MIRT2588883	hsa-miR-4719	CLIP-seq
MIRT1217728	hsa-miR-556-3p	CLIP-seq
MIRT2588884	hsa-miR-590-3p	CLIP-seq
MIRT2588885	hsa-miR-7	CLIP-seq
MIRT2588886	hsa-miR-759	CLIP-seq
MIRT1217731	hsa-miR-92a	CLIP-seq
MIRT1217732	hsa-miR-92b	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0005515	Function	Protein binding	IPI	21282530, 22493164, 24981860, 26496610, 27705803, 28514442, 33961781
GO:0005634	Component	Nucleus	IDA	21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006338	Process	Chromatin remodeling	IMP	26151332
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0031519	Component	PcG protein complex	IDA	21282530, 26151332
GO:0031519	Component	PcG protein complex	IEA
GO:0035102	Component	PRC1 complex	IBA
GO:0035102	Component	PRC1 complex	IDA	19636380
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	8521824
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
607816	21156	ENSG00000156374

Q9BYE7

Protein name

Polycomb group RING finger protein 6 (Mel18 and Bmi1-like RING finger) (RING finger protein 134)

Protein function

Transcriptional repressor (PubMed:12167161). May modulate the levels of histone H3K4Me3 by activating KDM5D histone demethylase (PubMed:17320162). Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to ma

PDB

2DJB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13923	zf-C3HC4_2	133 → 172		Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MEGVAVVTAGSVGAAKTEGAAALPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSR
PPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEE
RLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ
PLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAVPQPVPSSKGRSKKV
LESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDP
ACQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT

Sequence length

350

Interactions

View interactions

	KEGG		Reactome
	Polycomb repressive complex Signaling pathways regulating pluripotency of stem cells		Transcriptional Regulation by E2F6

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinogenesis	Associate	36890610	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Stimulate	36890610	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	26001296	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	18367492	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	32366400	★★★★★ ★☆☆☆☆ Found in Text Mining only

PCGF6 (polycomb group ring finger 6)