Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84107
Gene name Gene Name - the full gene name approved by the HGNC.
Zic family zinc finger 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZIC4
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q24
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT627179 hsa-miR-892a HITS-CLIP 23824327
MIRT627178 hsa-miR-6760-3p HITS-CLIP 23824327
MIRT640634 hsa-miR-1208 HITS-CLIP 23824327
MIRT627177 hsa-miR-181b-2-3p HITS-CLIP 23824327
MIRT627176 hsa-miR-181b-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003677 Function DNA binding ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608948 20393 ENSG00000174963
Protein
UniProt ID Q8N9L1
Protein name Zinc finger protein ZIC 4 (Zinc finger protein of the cerebellum 4)
Protein function Binds to DNA.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18366 zf_ZIC 121 166 Zic proteins zinc finger domain Domain
PF00096 zf-C2H2 204 228 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 264 288 Zinc finger, C2H2 type Domain
Sequence
MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLN
GLLRLGLPGDMYARPEPFPPGPAARSDALAAAAALHGYGGMNLTVNLAAPHGPGAFFRYM
RQPIKQELICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPR
QGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEG
CERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS
ATPSALVSPSSDCGHKSQVASSAAVAARTADLSE
Sequence length 334
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Brain Diseases Associate 31396565
Carnitine palmitoyl transferase 1A deficiency Associate 39266576
Cerebellar Ataxia Associate 32943444
Cerebellar Diseases Stimulate 15007130
Cerebellar Diseases Associate 32943444, 35997131
Choroid Plexus Neoplasms Associate 39266576
Dandy Walker Syndrome Associate 34238780
Glioma Associate 34475426
Head and Neck Neoplasms Associate 24786473, 27553089
Laryngeal Neoplasms Associate 27553089