Gene Gene information from NCBI Gene database.
Entrez ID 84107
Gene name Zic family zinc finger 4
Gene symbol ZIC4
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3q24
Summary This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked t
miRNA miRNA information provided by mirtarbase database.
111
miRTarBase ID miRNA Experiments Reference
MIRT627179 hsa-miR-892a HITS-CLIP 23824327
MIRT627178 hsa-miR-6760-3p HITS-CLIP 23824327
MIRT640634 hsa-miR-1208 HITS-CLIP 23824327
MIRT627177 hsa-miR-181b-2-3p HITS-CLIP 23824327
MIRT627176 hsa-miR-181b-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003677 Function DNA binding ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608948 20393 ENSG00000174963
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N9L1
Protein name Zinc finger protein ZIC 4 (Zinc finger protein of the cerebellum 4)
Protein function Binds to DNA.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18366 zf_ZIC 121 166 Zic proteins zinc finger domain Domain
PF00096 zf-C2H2 204 228 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 264 288 Zinc finger, C2H2 type Domain
Sequence
MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLN
GLLRLGLPGDMYARPEPFPPGPAARSDALAAAAALHGYGGMNLTVNLAAPHGPGAFFRYM
RQPIKQELICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPR
QGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEG
CERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS
ATPSALVSPSSDCGHKSQVASSAAVAARTADLSE
Sequence length 334
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Benign rs6766244 RCV005898423
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Brain Diseases Associate 31396565
Carnitine palmitoyl transferase 1A deficiency Associate 39266576
Cerebellar Ataxia Associate 32943444
Cerebellar Diseases Stimulate 15007130
Cerebellar Diseases Associate 32943444, 35997131
Choroid Plexus Neoplasms Associate 39266576
Dandy Walker Syndrome Associate 34238780
Glioma Associate 34475426
Head and Neck Neoplasms Associate 24786473, 27553089
Laryngeal Neoplasms Associate 27553089