Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84101
Gene name Gene Name - the full gene name approved by the HGNC.	Ubiquitin specific peptidase 44
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	USP44
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q22
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a protease that functions as a deubiquitinating enzyme. The encoded protein is thought to help regulate the spindle assembly checkpoint by preventing early anaphase onset. This protein specifically deubiquitinates CDC20

Show/Hide all(118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017223	hsa-miR-335-5p	Microarray	18185580
MIRT533307	hsa-miR-1276	PAR-CLIP	22012620
MIRT533306	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT533304	hsa-miR-4422	PAR-CLIP	22012620
MIRT533305	hsa-miR-4275	PAR-CLIP	22012620
MIRT533303	hsa-miR-450a-2-3p	PAR-CLIP	22012620
MIRT533302	hsa-miR-4260	PAR-CLIP	22012620
MIRT533301	hsa-miR-5572	PAR-CLIP	22012620
MIRT533307	hsa-miR-1276	PAR-CLIP	22012620
MIRT533306	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT533304	hsa-miR-4422	PAR-CLIP	22012620
MIRT533305	hsa-miR-4275	PAR-CLIP	22012620
MIRT533303	hsa-miR-450a-2-3p	PAR-CLIP	22012620
MIRT533302	hsa-miR-4260	PAR-CLIP	22012620
MIRT533301	hsa-miR-5572	PAR-CLIP	22012620
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479762	hsa-miR-1273f	CLIP-seq
MIRT1479763	hsa-miR-143	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479765	hsa-miR-30a	CLIP-seq
MIRT1479766	hsa-miR-30b	CLIP-seq
MIRT1479767	hsa-miR-30c	CLIP-seq
MIRT1479768	hsa-miR-30d	CLIP-seq
MIRT1479769	hsa-miR-30e	CLIP-seq
MIRT1479770	hsa-miR-3146	CLIP-seq
MIRT1479771	hsa-miR-3591-3p	CLIP-seq
MIRT1479772	hsa-miR-4305	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479776	hsa-miR-4708-5p	CLIP-seq
MIRT1479777	hsa-miR-4770	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479781	hsa-miR-1236	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479782	hsa-miR-4729	CLIP-seq
MIRT1479783	hsa-miR-4753-3p	CLIP-seq
MIRT1479784	hsa-miR-4768-5p	CLIP-seq
MIRT1479785	hsa-miR-4775	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479786	hsa-miR-590-3p	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT1921033	hsa-miR-615-3p	CLIP-seq
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479765	hsa-miR-30a	CLIP-seq
MIRT1479766	hsa-miR-30b	CLIP-seq
MIRT1479767	hsa-miR-30c	CLIP-seq
MIRT1479768	hsa-miR-30d	CLIP-seq
MIRT1479769	hsa-miR-30e	CLIP-seq
MIRT1479771	hsa-miR-3591-3p	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT2463058	hsa-miR-142-5p	CLIP-seq
MIRT2463059	hsa-miR-3658	CLIP-seq
MIRT2463060	hsa-miR-561	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	IDA	14715245, 17443180, 20402667
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	IMP	17443180, 20402667
GO:0005515	Function	Protein binding	IPI	17443180, 19615732, 28514442, 32644293
GO:0005634	Component	Nucleus	IDA	20402667
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0007049	Process	Cell cycle	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016579	Process	Protein deubiquitination	IDA	14715245, 17443180, 20402667
GO:0016579	Process	Protein deubiquitination	TAS
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0051301	Process	Cell division	IEA
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	ISS
GO:1904667	Process	Negative regulation of ubiquitin protein ligase activity	IMP	17443180

MIM	HGNC	e!Ensembl
610993	20064	ENSG00000136014

Protein

UniProt ID

Q9H0E7

Protein name

Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.4.19.12) (Deubiquitinating enzyme 44) (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44)

Protein function

Deubiquitinase that plays a key regulatory role in the spindle assembly checkpoint or mitotic checkpoint by preventing premature anaphase onset. Acts by specifically mediating deubiquitination of CDC20, a negative regulator of the anaphase promo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02148	zf-UBP	29 → 91	Zn-finger in ubiquitin-hydrolases and other protein	Domain
PF00443	UCH	273 → 675	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis. Expressed at high levels in T-cell acute lymphoblastic leukemia. {ECO:0000269|PubMed:14715245, ECO:0000269|PubMed:21853124}.

Sequence

MLAMDTCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYLCDDYVLNDNTTGDLKLLRRTLSAIKSQNYHCTTRSGRFL
RSMGTGDDSYFLHDGAQSLLQSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPF
QEKIVVKREVKKRRQELEYQVKAELESMPPRKSLRLQGLAQSTIIEIVSVQVPAQTPASP
AKDKVLSTSENEISQKVSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQC
FLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVCSRQSSLSSGLSGGA
SKGRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA
QQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCL
ACDNKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQC
NSKRRRFSSKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNM
EPYCCRETLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMC
TMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPNEDADTSSNEILS

Sequence length

712

Interactions

View interactions

	Reactome
			Ub-specific processing proteases

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	24837038
Adenoma	Inhibit	24837038
Aneuploidy	Associate	24837038
Aneuploidy	Stimulate	28544703
Breast Neoplasms	Associate	27880911
Carcinogenesis	Associate	28492742, 30622230
Carcinogenesis	Inhibit	35079021
Carcinoma Hepatocellular	Associate	37204480, 38097536
Carcinoma Non Small Cell Lung	Associate	31197957
Carcinoma Renal Cell	Associate	32164618, 32633782
Chromosomal Instability	Associate	28544703
Colorectal Neoplasms	Associate	24837038
Colorectal Neoplasms	Inhibit	32285989
Diabetes Mellitus Type 2	Associate	34502231
Glioma	Associate	32934196
Inflammation	Associate	32644293
Leukemia Myeloid Acute	Associate	34502231
Nasopharyngeal Carcinoma	Associate	35079021
Neoplasm Metastasis	Associate	30622230, 37204480
Neoplasms	Inhibit	24837038, 31197957, 32285989, 38097536
Neoplasms	Associate	24837038, 29089486, 30622230, 32164618, 32644293, 35079021, 37204480
Prostatic Neoplasms	Associate	30622230
Stomach Neoplasms	Associate	28544703

USP44 (ubiquitin specific peptidase 44)