Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84101
Gene name	Ubiquitin specific peptidase 44
Gene symbol	USP44
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q22
Summary	The protein encoded by this gene is a protease that functions as a deubiquitinating enzyme. The encoded protein is thought to help regulate the spindle assembly checkpoint by preventing early anaphase onset. This protein specifically deubiquitinates CDC20

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017223	hsa-miR-335-5p	Microarray	18185580
MIRT533307	hsa-miR-1276	PAR-CLIP	22012620
MIRT533306	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT533304	hsa-miR-4422	PAR-CLIP	22012620
MIRT533305	hsa-miR-4275	PAR-CLIP	22012620
MIRT533303	hsa-miR-450a-2-3p	PAR-CLIP	22012620
MIRT533302	hsa-miR-4260	PAR-CLIP	22012620
MIRT533301	hsa-miR-5572	PAR-CLIP	22012620
MIRT533307	hsa-miR-1276	PAR-CLIP	22012620
MIRT533306	hsa-miR-6835-3p	PAR-CLIP	22012620
MIRT533304	hsa-miR-4422	PAR-CLIP	22012620
MIRT533305	hsa-miR-4275	PAR-CLIP	22012620
MIRT533303	hsa-miR-450a-2-3p	PAR-CLIP	22012620
MIRT533302	hsa-miR-4260	PAR-CLIP	22012620
MIRT533301	hsa-miR-5572	PAR-CLIP	22012620
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479762	hsa-miR-1273f	CLIP-seq
MIRT1479763	hsa-miR-143	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479765	hsa-miR-30a	CLIP-seq
MIRT1479766	hsa-miR-30b	CLIP-seq
MIRT1479767	hsa-miR-30c	CLIP-seq
MIRT1479768	hsa-miR-30d	CLIP-seq
MIRT1479769	hsa-miR-30e	CLIP-seq
MIRT1479770	hsa-miR-3146	CLIP-seq
MIRT1479771	hsa-miR-3591-3p	CLIP-seq
MIRT1479772	hsa-miR-4305	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479776	hsa-miR-4708-5p	CLIP-seq
MIRT1479777	hsa-miR-4770	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479781	hsa-miR-1236	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479782	hsa-miR-4729	CLIP-seq
MIRT1479783	hsa-miR-4753-3p	CLIP-seq
MIRT1479784	hsa-miR-4768-5p	CLIP-seq
MIRT1479785	hsa-miR-4775	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479786	hsa-miR-590-3p	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT1921033	hsa-miR-615-3p	CLIP-seq
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479765	hsa-miR-30a	CLIP-seq
MIRT1479766	hsa-miR-30b	CLIP-seq
MIRT1479767	hsa-miR-30c	CLIP-seq
MIRT1479768	hsa-miR-30d	CLIP-seq
MIRT1479769	hsa-miR-30e	CLIP-seq
MIRT1479771	hsa-miR-3591-3p	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT1479754	hsa-let-7a	CLIP-seq
MIRT1479755	hsa-let-7b	CLIP-seq
MIRT1479756	hsa-let-7c	CLIP-seq
MIRT1479757	hsa-let-7d	CLIP-seq
MIRT1479758	hsa-let-7e	CLIP-seq
MIRT1479759	hsa-let-7f	CLIP-seq
MIRT1479760	hsa-let-7g	CLIP-seq
MIRT1479761	hsa-let-7i	CLIP-seq
MIRT1479764	hsa-miR-202	CLIP-seq
MIRT1479773	hsa-miR-4458	CLIP-seq
MIRT1479774	hsa-miR-4500	CLIP-seq
MIRT1479775	hsa-miR-4649-3p	CLIP-seq
MIRT1479778	hsa-miR-583	CLIP-seq
MIRT1479779	hsa-miR-622	CLIP-seq
MIRT1479780	hsa-miR-98	CLIP-seq
MIRT2463058	hsa-miR-142-5p	CLIP-seq
MIRT2463059	hsa-miR-3658	CLIP-seq
MIRT2463060	hsa-miR-561	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISS	33937266
GO:0002376	Process	Immune system process	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	14715245, 17443180, 20402667
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	17443180, 20402667
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	17443180, 19615732, 28514442, 32644293, 33961781
GO:0005634	Component	Nucleus	IDA	32644293
GO:0005634	Component	Nucleus	IDA	20402667
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	31968013
GO:0005737	Component	Cytoplasm	IEA
GO:0006289	Process	Nucleotide-excision repair	ISS	33937266
GO:0006289	Process	Nucleotide-excision repair	ISS	33937266
GO:0006508	Process	Proteolysis	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010564	Process	Regulation of cell cycle process	IBA
GO:0016579	Process	Protein deubiquitination	IDA	17443180, 20402667
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0045066	Process	Regulatory T cell differentiation	IDA	32644293
GO:0045066	Process	Regulatory T cell differentiation	IDA	32644293
GO:0045087	Process	Innate immune response	IEA
GO:0045841	Process	Negative regulation of mitotic metaphase/anaphase transition	IDA	17443180
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IDA	9637688
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IC	17443180
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IEA
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	ISS
GO:0101005	Function	Deubiquitinase activity	IDA	17443180, 31968013, 32644293
GO:0101005	Function	Deubiquitinase activity	ISS	33937266
GO:0140374	Process	Antiviral innate immune response	IDA	21074459, 22394562
GO:0140374	Process	Antiviral innate immune response	IDA	31968013
GO:1904667	Process	Negative regulation of ubiquitin protein ligase activity	IMP	17443180

MIM	HGNC	e!Ensembl
610993	20064	ENSG00000136014

Q9H0E7

Protein name

Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.4.19.12) (Deubiquitinating enzyme 44) (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44)

Protein function

Deubiquitinase that plays a key regulatory role in the spindle assembly checkpoint or mitotic checkpoint by preventing premature anaphase onset. Acts by specifically mediating deubiquitination of CDC20, a negative regulator of the anaphase promo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02148	zf-UBP	29 → 91	Zn-finger in ubiquitin-hydrolases and other protein	Domain
PF00443	UCH	273 → 675	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis. Expressed at high levels in T-cell acute lymphoblastic leukemia. {ECO:0000269|PubMed:14715245, ECO:0000269|PubMed:21853124}.

Sequence

MLAMDTCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYLCDDYVLNDNTTGDLKLLRRTLSAIKSQNYHCTTRSGRFL
RSMGTGDDSYFLHDGAQSLLQSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPF
QEKIVVKREVKKRRQELEYQVKAELESMPPRKSLRLQGLAQSTIIEIVSVQVPAQTPASP
AKDKVLSTSENEISQKVSDSSVKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQC
FLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVCSRQSSLSSGLSGGA
SKGRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA
QQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCL
ACDNKSNTIEPFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQC
NSKRRRFSSKPVVLTEAQKQLMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNM
EPYCCRETLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMC
TMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPNEDADTSSNEILS

Sequence length

712

Interactions

View interactions

	Reactome
			Ub-specific processing proteases

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Moderate intellectual disability	Uncertain significance	rs2077088044	RCV001089806
USP44-related disorder	Likely benign; Benign	rs377219944, rs550452419, rs145220201, rs761232870, rs147287763, rs61733460	RCV003952131 RCV003949797 RCV003954403 RCV003969140 RCV003964249 RCV003968078

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenoma	Associate	24837038
Adenoma	Inhibit	24837038
Aneuploidy	Associate	24837038
Aneuploidy	Stimulate	28544703
Breast Neoplasms	Associate	27880911
Carcinogenesis	Associate	28492742, 30622230
Carcinogenesis	Inhibit	35079021
Carcinoma Hepatocellular	Associate	37204480, 38097536
Carcinoma Non Small Cell Lung	Associate	31197957
Carcinoma Renal Cell	Associate	32164618, 32633782
Chromosomal Instability	Associate	28544703
Colorectal Neoplasms	Associate	24837038
Colorectal Neoplasms	Inhibit	32285989
Diabetes Mellitus Type 2	Associate	34502231
Glioma	Associate	32934196
Inflammation	Associate	32644293
Leukemia Myeloid Acute	Associate	34502231
Nasopharyngeal Carcinoma	Associate	35079021
Neoplasm Metastasis	Associate	30622230, 37204480
Neoplasms	Inhibit	24837038, 31197957, 32285989, 38097536
Neoplasms	Associate	24837038, 29089486, 30622230, 32164618, 32644293, 35079021, 37204480
Prostatic Neoplasms	Associate	30622230
Stomach Neoplasms	Associate	28544703

USP44 (ubiquitin specific peptidase 44)