Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84100
Gene name Gene Name - the full gene name approved by the HGNC.	ARF like GTPase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ARL6
Synonyms (NCBI Gene) Gene synonyms aliases	BBS3, RP55
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl

Show/Hide all(12)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893678	C>T	Pathogenic	Non coding transcript variant, stop gained, coding sequence variant
rs104893679	G>C,T	Pathogenic, risk-factor	Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs104893680	C>G,T	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs104893681	T>C,G	Pathogenic	Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs137854907	T>C	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs587777805	C>G,T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs765715798	G>A	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs771054395	T>C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs888140182	T>A,C	Likely-pathogenic	Stop gained, synonymous variant, coding sequence variant, non coding transcript variant
rs1057515576	TAT>GAAAA	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant
rs1559679965	G>C	Pathogenic	Splice donor variant
rs1576465252	TTTTCTCTTTTA>-	Likely-pathogenic	Intron variant, splice acceptor variant

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046980	hsa-miR-218-5p	CLASH	23622248
MIRT798375	hsa-miR-3163	CLIP-seq
MIRT798376	hsa-miR-487a	CLIP-seq
MIRT798377	hsa-miR-656	CLIP-seq
MIRT1935772	hsa-miR-4645-3p	CLIP-seq
MIRT1935773	hsa-miR-4789-3p	CLIP-seq
MIRT1935774	hsa-miR-642b	CLIP-seq
MIRT2479155	hsa-miR-105	CLIP-seq
MIRT2479156	hsa-miR-1233	CLIP-seq
MIRT2479157	hsa-miR-129-3p	CLIP-seq
MIRT2479158	hsa-miR-1304	CLIP-seq
MIRT2479159	hsa-miR-1321	CLIP-seq
MIRT2479160	hsa-miR-3126-5p	CLIP-seq
MIRT2479161	hsa-miR-3161	CLIP-seq
MIRT2479162	hsa-miR-3162-5p	CLIP-seq
MIRT2479163	hsa-miR-3668	CLIP-seq
MIRT2479164	hsa-miR-3684	CLIP-seq
MIRT2479165	hsa-miR-4419a	CLIP-seq
MIRT2479166	hsa-miR-4510	CLIP-seq
MIRT2479167	hsa-miR-4511	CLIP-seq
MIRT2479168	hsa-miR-4739	CLIP-seq
MIRT2479169	hsa-miR-4756-5p	CLIP-seq
MIRT1935773	hsa-miR-4789-3p	CLIP-seq
MIRT2479170	hsa-miR-543	CLIP-seq
MIRT2479171	hsa-miR-548b-3p	CLIP-seq
MIRT2479172	hsa-miR-548c-3p	CLIP-seq
MIRT1935774	hsa-miR-642b	CLIP-seq
MIRT798377	hsa-miR-656	CLIP-seq
MIRT2479173	hsa-miR-660	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	20603001, 22139371, 25402481, 25443296
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005543	Function	Phospholipid binding	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IDA	17646400
GO:0005929	Component	Cilium	IDA	22139371
GO:0005929	Component	Cilium	TAS
GO:0005930	Component	Axoneme	IBA
GO:0005930	Component	Axoneme	ISS
GO:0006612	Process	Protein targeting to membrane	ISS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0007368	Process	Determination of left/right symmetry	ISS
GO:0007420	Process	Brain development	IEA
GO:0007601	Process	Visual perception	IEA
GO:0008589	Process	Regulation of smoothened signaling pathway	IEA
GO:0010842	Process	Retina layer formation	IEA
GO:0015031	Process	Protein transport	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016055	Process	Wnt signaling pathway	IMP	20207729
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0030030	Process	Cell projection organization	IEA
GO:0030117	Component	Membrane coat	ISS
GO:0032402	Process	Melanosome transport	ISS
GO:0042995	Component	Cell projection	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051258	Process	Protein polymerization	ISS
GO:0060271	Process	Cilium assembly	IBA
GO:0060271	Process	Cilium assembly	IEA
GO:0060271	Process	Cilium assembly	IMP	20207729
GO:0060271	Process	Cilium assembly	ISS
GO:0061512	Process	Protein localization to cilium	IBA
GO:0061512	Process	Protein localization to cilium	IEA
GO:0061512	Process	Protein localization to cilium	IMP	22139371
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097499	Process	Protein localization to non-motile cilium	IEA
GO:1903445	Process	Protein transport from ciliary membrane to plasma membrane	IEA

MIM	HGNC	e!Ensembl
608845	13210	ENSG00000113966

Protein

UniProt ID

Q9H0F7

Protein name

ADP-ribosylation factor-like protein 6 (Bardet-Biedl syndrome 3 protein)

Protein function

Involved in membrane protein trafficking at the base of the ciliary organelle. Mediates recruitment onto plasma membrane of the BBSome complex which would constitute a coat complex required for sorting of specific membrane proteins to the primar

PDB

2H57

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00025	Arf	4 → 181	ADP-ribosylation factor family	Domain

Sequence

MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKS
SSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKH
RRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQ
IQTVKT

Sequence length

186

Interactions

View interactions

	Reactome
			BBSome-mediated cargo-targeting to cilium

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Bardet-Biedl Syndrome	bardet-biedl syndrome, bardet-biedl syndrome 3, Bardet-Biedl syndrome 1, modifier of	rs104893678, rs137854907, rs1057515576, rs104893679, rs2037751886, rs104893680, rs2037752645, rs104893681	N/A
retinal dystrophy	Retinal dystrophy	rs104893678, rs104893680	N/A
Retinitis Pigmentosa	retinitis pigmentosa, Autosomal recessive retinitis pigmentosa	rs771054395, rs104893680, rs587777805	N/A

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Bardet Biedl Syndrome	Associate	10577922, 11179009, 12677556, 20142850, 20207729, 24608809, 27708425, 29590217, 29806606, 36550847, 36833331
Bardet Biedl Syndrome	Stimulate	36550847
Carcinoma Hepatocellular	Stimulate	38169538
Deafness Autosomal Recessive 31	Associate	29806606
Fundus Albipunctatus	Associate	36550847
Immunoglobulin G4 Related Disease	Associate	31736247
Neoplasms	Associate	30338611, 38169538
Nijmegen Breakage Syndrome	Associate	20207729, 31888296
Refsum Disease Infantile	Associate	40384762
Retinal Degeneration	Associate	28130426
Retinitis Pigmentosa	Associate	19956407

ARL6 (ARF like GTPase 6)