Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	841
Gene name	Caspase 8
Gene symbol	CASP8
Synonyms (NCBI Gene)	ALPS2BCAP4Casp-8FLICEMACHMCH5
Chromosome	2
Chromosome location	2q33.1
Summary	This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large pro

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs17860424	C>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs587776665	GT>-	Pathogenic	Downstream transcript variant, genic downstream transcript variant, frameshift variant, non coding transcript variant, coding sequence variant

374

Show/Hide all (374)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005293	hsa-let-7a-5p	Western blot	18758960
MIRT006278	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT006278	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT006278	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT029158	hsa-miR-26b-5p	Microarray	19088304
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT204830	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT682669	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT682668	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT682667	hsa-miR-940	HITS-CLIP	23706177
MIRT682666	hsa-miR-3929	HITS-CLIP	23706177
MIRT682665	hsa-miR-4419b	HITS-CLIP	23706177
MIRT682664	hsa-miR-4478	HITS-CLIP	23706177
MIRT682663	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT682662	hsa-miR-6746-5p	HITS-CLIP	23706177
MIRT682661	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT682660	hsa-miR-1827	HITS-CLIP	23706177
MIRT682659	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT682658	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT682657	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT682656	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT682655	hsa-miR-6735-3p	HITS-CLIP	23706177
MIRT682654	hsa-miR-6771-5p	HITS-CLIP	23706177
MIRT682653	hsa-miR-665	HITS-CLIP	23706177
MIRT527678	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT527677	hsa-miR-5688	PAR-CLIP	22012620
MIRT527676	hsa-miR-29a-3p	PAR-CLIP	22012620
MIRT527675	hsa-miR-29b-3p	PAR-CLIP	22012620
MIRT527674	hsa-miR-29c-3p	PAR-CLIP	22012620
MIRT527673	hsa-miR-6871-3p	PAR-CLIP	22012620
MIRT527672	hsa-miR-767-5p	PAR-CLIP	22012620
MIRT527671	hsa-miR-5682	PAR-CLIP	22012620
MIRT731940	hsa-miR-376a-3p	Luciferase reporter assayqRT-PCRWestern blot	27979415
MIRT731940	hsa-miR-376a-3p	Luciferase reporter assayqRT-PCRWestern blot	27979415
MIRT731940	hsa-miR-376a-3p	PAR-CLIP	27292025
MIRT733649	hsa-miR-149-5p	qRT-PCR	34051087
MIRT733649	hsa-miR-149-5p	qRT-PCR	34051087
MIRT735255	hsa-miR-21-3p	MicroarrayqRT-PCR	32407273
MIRT736406	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT682669	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT682668	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT682667	hsa-miR-940	HITS-CLIP	23706177
MIRT682666	hsa-miR-3929	HITS-CLIP	23706177
MIRT682665	hsa-miR-4419b	HITS-CLIP	23706177
MIRT682664	hsa-miR-4478	HITS-CLIP	23706177
MIRT682663	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT682662	hsa-miR-6746-5p	HITS-CLIP	23706177
MIRT682661	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT682660	hsa-miR-1827	HITS-CLIP	23706177
MIRT682659	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT682658	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT682657	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT682656	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT682655	hsa-miR-6735-3p	HITS-CLIP	23706177
MIRT682654	hsa-miR-6771-5p	HITS-CLIP	23706177
MIRT682653	hsa-miR-665	HITS-CLIP	23706177
MIRT527678	hsa-miR-495-3p	PAR-CLIP	22012620
MIRT527677	hsa-miR-5688	PAR-CLIP	22012620
MIRT527676	hsa-miR-29a-3p	PAR-CLIP	22012620
MIRT527675	hsa-miR-29b-3p	PAR-CLIP	22012620
MIRT527674	hsa-miR-29c-3p	PAR-CLIP	22012620
MIRT527673	hsa-miR-6871-3p	PAR-CLIP	22012620
MIRT527672	hsa-miR-767-5p	PAR-CLIP	22012620
MIRT527671	hsa-miR-5682	PAR-CLIP	22012620
MIRT755543	hsa-miR-181c-5p	Western blottingqRT-PCR	36676955
MIRT864185	hsa-miR-1184	CLIP-seq
MIRT864186	hsa-miR-1226	CLIP-seq
MIRT864187	hsa-miR-1231	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT864190	hsa-miR-137	CLIP-seq
MIRT864191	hsa-miR-192	CLIP-seq
MIRT864192	hsa-miR-215	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT864194	hsa-miR-3064-3p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT864199	hsa-miR-3940-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864202	hsa-miR-4418	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864204	hsa-miR-4486	CLIP-seq
MIRT864205	hsa-miR-4490	CLIP-seq
MIRT864206	hsa-miR-4507	CLIP-seq
MIRT864207	hsa-miR-4537	CLIP-seq
MIRT864208	hsa-miR-4649-5p	CLIP-seq
MIRT864209	hsa-miR-4715-3p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT864211	hsa-miR-4746-3p	CLIP-seq
MIRT864212	hsa-miR-4755-3p	CLIP-seq
MIRT864213	hsa-miR-4774-5p	CLIP-seq
MIRT864214	hsa-miR-4792	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864217	hsa-miR-509-3-5p	CLIP-seq
MIRT864218	hsa-miR-509-5p	CLIP-seq
MIRT864219	hsa-miR-548ac	CLIP-seq
MIRT864220	hsa-miR-548ae	CLIP-seq
MIRT864221	hsa-miR-548aj	CLIP-seq
MIRT864222	hsa-miR-548am	CLIP-seq
MIRT864223	hsa-miR-548d-3p	CLIP-seq
MIRT864224	hsa-miR-548x	CLIP-seq
MIRT864225	hsa-miR-548z	CLIP-seq
MIRT864226	hsa-miR-635	CLIP-seq
MIRT864227	hsa-miR-661	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT864186	hsa-miR-1226	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT864190	hsa-miR-137	CLIP-seq
MIRT864194	hsa-miR-3064-3p	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864230	hsa-miR-3165	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864234	hsa-miR-4433	CLIP-seq
MIRT864235	hsa-miR-4459	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864207	hsa-miR-4537	CLIP-seq
MIRT864236	hsa-miR-4683	CLIP-seq
MIRT864209	hsa-miR-4715-3p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT864211	hsa-miR-4746-3p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT864214	hsa-miR-4792	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT864238	hsa-miR-495	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864239	hsa-miR-543	CLIP-seq
MIRT864219	hsa-miR-548ac	CLIP-seq
MIRT864220	hsa-miR-548ae	CLIP-seq
MIRT864221	hsa-miR-548aj	CLIP-seq
MIRT864222	hsa-miR-548am	CLIP-seq
MIRT864223	hsa-miR-548d-3p	CLIP-seq
MIRT864224	hsa-miR-548x	CLIP-seq
MIRT864225	hsa-miR-548z	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT864185	hsa-miR-1184	CLIP-seq
MIRT864191	hsa-miR-192	CLIP-seq
MIRT864192	hsa-miR-215	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT1956164	hsa-miR-3944-5p	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864202	hsa-miR-4418	CLIP-seq
MIRT864207	hsa-miR-4537	CLIP-seq
MIRT1956165	hsa-miR-4658	CLIP-seq
MIRT864211	hsa-miR-4746-3p	CLIP-seq
MIRT1956166	hsa-miR-4758-5p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT864214	hsa-miR-4792	CLIP-seq
MIRT864217	hsa-miR-509-3-5p	CLIP-seq
MIRT864218	hsa-miR-509-5p	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT2193822	hsa-miR-3074-3p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864230	hsa-miR-3165	CLIP-seq
MIRT2193823	hsa-miR-3653	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT2193824	hsa-miR-3942-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864234	hsa-miR-4433	CLIP-seq
MIRT864235	hsa-miR-4459	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864204	hsa-miR-4486	CLIP-seq
MIRT864207	hsa-miR-4537	CLIP-seq
MIRT864208	hsa-miR-4649-5p	CLIP-seq
MIRT864236	hsa-miR-4683	CLIP-seq
MIRT2193825	hsa-miR-4703-5p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT864211	hsa-miR-4746-3p	CLIP-seq
MIRT864214	hsa-miR-4792	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT2193826	hsa-miR-487a	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864226	hsa-miR-635	CLIP-seq
MIRT864227	hsa-miR-661	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT2497039	hsa-miR-106a	CLIP-seq
MIRT2497040	hsa-miR-106b	CLIP-seq
MIRT2497041	hsa-miR-10a	CLIP-seq
MIRT2497042	hsa-miR-10b	CLIP-seq
MIRT864185	hsa-miR-1184	CLIP-seq
MIRT2497043	hsa-miR-1224-3p	CLIP-seq
MIRT2497044	hsa-miR-1260	CLIP-seq
MIRT2497045	hsa-miR-1260b	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT2497046	hsa-miR-128	CLIP-seq
MIRT2497047	hsa-miR-1280	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT2497048	hsa-miR-150	CLIP-seq
MIRT2497049	hsa-miR-17	CLIP-seq
MIRT2497050	hsa-miR-1908	CLIP-seq
MIRT864191	hsa-miR-192	CLIP-seq
MIRT2497051	hsa-miR-20a	CLIP-seq
MIRT2497052	hsa-miR-20b	CLIP-seq
MIRT2497053	hsa-miR-2114	CLIP-seq
MIRT864192	hsa-miR-215	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT2497054	hsa-miR-302a	CLIP-seq
MIRT2497055	hsa-miR-302b	CLIP-seq
MIRT2497056	hsa-miR-302c	CLIP-seq
MIRT2497057	hsa-miR-302d	CLIP-seq
MIRT2497058	hsa-miR-302e	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864230	hsa-miR-3165	CLIP-seq
MIRT2497059	hsa-miR-339-5p	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT2497060	hsa-miR-372	CLIP-seq
MIRT2497061	hsa-miR-373	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT2497062	hsa-miR-3934	CLIP-seq
MIRT864199	hsa-miR-3940-5p	CLIP-seq
MIRT1956164	hsa-miR-3944-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864202	hsa-miR-4418	CLIP-seq
MIRT2497063	hsa-miR-4421	CLIP-seq
MIRT864234	hsa-miR-4433	CLIP-seq
MIRT864235	hsa-miR-4459	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864204	hsa-miR-4486	CLIP-seq
MIRT864206	hsa-miR-4507	CLIP-seq
MIRT864208	hsa-miR-4649-5p	CLIP-seq
MIRT1956165	hsa-miR-4658	CLIP-seq
MIRT2497064	hsa-miR-4662a-5p	CLIP-seq
MIRT2497065	hsa-miR-4676-5p	CLIP-seq
MIRT864236	hsa-miR-4683	CLIP-seq
MIRT2497066	hsa-miR-4684-5p	CLIP-seq
MIRT2497067	hsa-miR-4714-3p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT2497068	hsa-miR-4731-5p	CLIP-seq
MIRT1956166	hsa-miR-4758-5p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT2497069	hsa-miR-498	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864217	hsa-miR-509-3-5p	CLIP-seq
MIRT864218	hsa-miR-509-5p	CLIP-seq
MIRT2497070	hsa-miR-512-3p	CLIP-seq
MIRT2497071	hsa-miR-519d	CLIP-seq
MIRT2497072	hsa-miR-520a-3p	CLIP-seq
MIRT2497073	hsa-miR-520b	CLIP-seq
MIRT2497074	hsa-miR-520c-3p	CLIP-seq
MIRT2497075	hsa-miR-520d-3p	CLIP-seq
MIRT2497076	hsa-miR-520e	CLIP-seq
MIRT2497077	hsa-miR-520g	CLIP-seq
MIRT2497078	hsa-miR-520h	CLIP-seq
MIRT2497079	hsa-miR-532-3p	CLIP-seq
MIRT2497080	hsa-miR-548c-3p	CLIP-seq
MIRT2497081	hsa-miR-575	CLIP-seq
MIRT2497082	hsa-miR-593	CLIP-seq
MIRT864226	hsa-miR-635	CLIP-seq
MIRT864227	hsa-miR-661	CLIP-seq
MIRT2497083	hsa-miR-663	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT2497084	hsa-miR-93	CLIP-seq
MIRT2497039	hsa-miR-106a	CLIP-seq
MIRT2497040	hsa-miR-106b	CLIP-seq
MIRT2497041	hsa-miR-10a	CLIP-seq
MIRT2497042	hsa-miR-10b	CLIP-seq
MIRT864185	hsa-miR-1184	CLIP-seq
MIRT2497043	hsa-miR-1224-3p	CLIP-seq
MIRT2497044	hsa-miR-1260	CLIP-seq
MIRT2497045	hsa-miR-1260b	CLIP-seq
MIRT864188	hsa-miR-1273	CLIP-seq
MIRT2497046	hsa-miR-128	CLIP-seq
MIRT2497047	hsa-miR-1280	CLIP-seq
MIRT864189	hsa-miR-1293	CLIP-seq
MIRT2497048	hsa-miR-150	CLIP-seq
MIRT2497049	hsa-miR-17	CLIP-seq
MIRT2497050	hsa-miR-1908	CLIP-seq
MIRT864191	hsa-miR-192	CLIP-seq
MIRT2497051	hsa-miR-20a	CLIP-seq
MIRT2497052	hsa-miR-20b	CLIP-seq
MIRT2497053	hsa-miR-2114	CLIP-seq
MIRT864192	hsa-miR-215	CLIP-seq
MIRT864193	hsa-miR-24	CLIP-seq
MIRT2497054	hsa-miR-302a	CLIP-seq
MIRT2497055	hsa-miR-302b	CLIP-seq
MIRT2497056	hsa-miR-302c	CLIP-seq
MIRT2497057	hsa-miR-302d	CLIP-seq
MIRT2497058	hsa-miR-302e	CLIP-seq
MIRT864229	hsa-miR-3120-5p	CLIP-seq
MIRT864195	hsa-miR-3122	CLIP-seq
MIRT864230	hsa-miR-3165	CLIP-seq
MIRT2497059	hsa-miR-339-5p	CLIP-seq
MIRT864231	hsa-miR-3613-3p	CLIP-seq
MIRT864196	hsa-miR-3689a-3p	CLIP-seq
MIRT864197	hsa-miR-3689c	CLIP-seq
MIRT864232	hsa-miR-371-5p	CLIP-seq
MIRT864233	hsa-miR-371b-5p	CLIP-seq
MIRT2497060	hsa-miR-372	CLIP-seq
MIRT2497061	hsa-miR-373	CLIP-seq
MIRT864198	hsa-miR-3913-5p	CLIP-seq
MIRT2497062	hsa-miR-3934	CLIP-seq
MIRT864199	hsa-miR-3940-5p	CLIP-seq
MIRT1956164	hsa-miR-3944-5p	CLIP-seq
MIRT864200	hsa-miR-4252	CLIP-seq
MIRT864201	hsa-miR-4284	CLIP-seq
MIRT864202	hsa-miR-4418	CLIP-seq
MIRT2497063	hsa-miR-4421	CLIP-seq
MIRT864234	hsa-miR-4433	CLIP-seq
MIRT864235	hsa-miR-4459	CLIP-seq
MIRT864203	hsa-miR-4483	CLIP-seq
MIRT864204	hsa-miR-4486	CLIP-seq
MIRT864206	hsa-miR-4507	CLIP-seq
MIRT864208	hsa-miR-4649-5p	CLIP-seq
MIRT1956165	hsa-miR-4658	CLIP-seq
MIRT2497064	hsa-miR-4662a-5p	CLIP-seq
MIRT2497065	hsa-miR-4676-5p	CLIP-seq
MIRT864236	hsa-miR-4683	CLIP-seq
MIRT2497066	hsa-miR-4684-5p	CLIP-seq
MIRT2497067	hsa-miR-4714-3p	CLIP-seq
MIRT864210	hsa-miR-4728-5p	CLIP-seq
MIRT2497068	hsa-miR-4731-5p	CLIP-seq
MIRT1956166	hsa-miR-4758-5p	CLIP-seq
MIRT864237	hsa-miR-4778-5p	CLIP-seq
MIRT864215	hsa-miR-4793-3p	CLIP-seq
MIRT2497069	hsa-miR-498	CLIP-seq
MIRT864216	hsa-miR-508-5p	CLIP-seq
MIRT864217	hsa-miR-509-3-5p	CLIP-seq
MIRT864218	hsa-miR-509-5p	CLIP-seq
MIRT2497070	hsa-miR-512-3p	CLIP-seq
MIRT2497071	hsa-miR-519d	CLIP-seq
MIRT2497072	hsa-miR-520a-3p	CLIP-seq
MIRT2497073	hsa-miR-520b	CLIP-seq
MIRT2497074	hsa-miR-520c-3p	CLIP-seq
MIRT2497075	hsa-miR-520d-3p	CLIP-seq
MIRT2497076	hsa-miR-520e	CLIP-seq
MIRT2497077	hsa-miR-520g	CLIP-seq
MIRT2497078	hsa-miR-520h	CLIP-seq
MIRT2497079	hsa-miR-532-3p	CLIP-seq
MIRT2497080	hsa-miR-548c-3p	CLIP-seq
MIRT2497081	hsa-miR-575	CLIP-seq
MIRT2497082	hsa-miR-593	CLIP-seq
MIRT864226	hsa-miR-635	CLIP-seq
MIRT864227	hsa-miR-661	CLIP-seq
MIRT2497083	hsa-miR-663	CLIP-seq
MIRT864228	hsa-miR-766	CLIP-seq
MIRT2497084	hsa-miR-93	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
CEBPD	Unknown	24810056
CREB1	Activation	18342014
DNMT1	Repression	20398055
MEN1	Activation	17766243
RUNX3	Activation	15930301

109

Show/Hide all (109)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	ISS
GO:0001525	Process	Angiogenesis	ISS
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001817	Process	Regulation of cytokine production	ISS
GO:0002682	Process	Regulation of immune system process	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	16916640, 16920334, 19240112, 31827280, 32929201, 33852854, 34012073, 35594856
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	11717445, 21737330, 21980415
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	8681376
GO:0005123	Function	Death receptor binding	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	8681376, 9208847, 9334338, 9343261, 9560245, 10442631, 10508784, 10508785, 12198154, 12884866, 12887920, 12888622, 14612908, 15069192, 15509781, 16498403, 16936772, 17047155, 17159907, 17170703, 17245429, 17479112, 18086677, 18245485, 18328427, 18485876, 18846110, 19060883, 19416807
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17167422
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	TAS	10891503
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005829	Component	Cytosol	IDA	17167422
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	TAS	10891503
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	12888622
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	22891283
GO:0007507	Process	Heart development	ISS
GO:0008233	Function	Peptidase activity	IDA	19740745
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	IMP	17047155
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	TAS	8681376
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IBA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	9184224
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IEA
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0016485	Process	Protein processing	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030027	Component	Lamellipodium	IDA	18216014
GO:0030027	Component	Lamellipodium	IEA
GO:0030101	Process	Natural killer cell activation	TAS	18309324
GO:0030154	Process	Cell differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IBA
GO:0030225	Process	Macrophage differentiation	TAS	18309324
GO:0030335	Process	Positive regulation of cell migration	IDA	18216014
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870, 21803845
GO:0031264	Component	Death-inducing signaling complex	IEA
GO:0031265	Component	CD95 death-inducing signaling complex	IBA
GO:0031265	Component	CD95 death-inducing signaling complex	IDA	11717445
GO:0031265	Component	CD95 death-inducing signaling complex	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	15069192
GO:0032025	Process	Response to cobalt ion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	22267217
GO:0032991	Component	Protein-containing complex	IDA	22267217
GO:0032991	Component	Protein-containing complex	IEA
GO:0034612	Process	Response to tumor necrosis factor	IMP	10521396
GO:0035877	Function	Death effector domain binding	IPI	11717445
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	21785459
GO:0042110	Process	T cell activation	TAS	18309324
GO:0042113	Process	B cell activation	TAS	18309324
GO:0042802	Function	Identical protein binding	IPI	16169070, 17170703
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043009	Process	Chordate embryonic development	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	12884866
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	17047155
GO:0043525	Process	Positive regulation of neuron apoptotic process	IBA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044297	Component	Cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045088	Process	Regulation of innate immune response	ISS
GO:0045471	Process	Response to ethanol	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	17047155
GO:0045862	Process	Positive regulation of proteolysis	IDA	18387192
GO:0048513	Process	Animal organ development	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IMP	10521396
GO:0051603	Process	Proteolysis involved in protein catabolic process	ISS
GO:0051604	Process	Protein maturation	IDA	33852854, 35594856
GO:0051604	Process	Protein maturation	IDA	16916640, 33852854, 35594856
GO:0051604	Process	Protein maturation	IEA
GO:0060546	Process	Negative regulation of necroptotic process	IDA	31827280
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0060546	Process	Negative regulation of necroptotic process	ISS
GO:0060715	Process	Syncytiotrophoblast cell differentiation involved in labyrinthine layer development	TAS	18309324
GO:0070269	Process	Pyroptotic inflammatory response	IDA	33852854, 35594856
GO:0070269	Process	Pyroptotic inflammatory response	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0072347	Process	Response to anesthetic	IEA
GO:0097110	Function	Scaffold protein binding	IPI	21785459
GO:0097190	Process	Apoptotic signaling pathway	IMP	11101870
GO:0097190	Process	Apoptotic signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	21785459, 35446120
GO:0097194	Process	Execution phase of apoptosis	IDA	16916640
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097194	Process	Execution phase of apoptosis	IMP	21737330
GO:0097194	Process	Execution phase of apoptosis	ISS
GO:0097264	Process	Self proteolysis	ISS
GO:0097342	Component	Ripoptosome	IDA	21737330
GO:0140639	Process	Positive regulation of pyroptotic inflammatory response	IDA	33852854
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IDA	16916640

MIM	HGNC	e!Ensembl
601763	1509	ENSG00000064012

Q14790

Protein name

Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Casp

Protein function

Thiol protease that plays a key role in programmed cell death by acting as a molecular switch for apoptosis, necroptosis and pyroptosis, and is required to prevent tissue damage during embryonic development and adulthood (PubMed:23516580, PubMed

PDB

1F9E , 1I4E , 1QDU , 1QTN , 2C2Z , 2FUN , 2K7Z , 2Y1L , 3H11 , 3KJN , 3KJQ , 4JJ7 , 4PRZ , 4PS1 , 4ZBW , 5H31 , 5H33 , 5JQE , 5L08 , 6AGW , 6PX9 , 7DEE , 7LVJ , 7LVM , 8YBX , 8YD7 , 8YD8 , 8YM4 , 8YM5 , 8YM6 , 8YNI , 8YNK , 8YNL , 8YNM , 8YNN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01335	DED	3 → 84	Death effector domain	Domain
PF01335	DED	101 → 180	Death effector domain	Domain
PF00656	Peptidase_C14	234 → 476		Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle.

Sequence

MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSF
KFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN
NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ
LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD

Sequence length

479

Interactions

View interactions

	KEGG		Reactome
	Platinum drug resistance p53 signaling pathway Apoptosis Apoptosis - multiple species Necroptosis Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway C-type lectin receptor signaling pathway IL-17 signaling pathway TNF signaling pathway Non-alcoholic fatty liver disease Alcoholic liver disease Alzheimer disease Huntington disease Pathways of neurodegeneration - multiple diseases Pathogenic Escherichia coli infection Salmonella infection Legionellosis Chagas disease Toxoplasmosis Tuberculosis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Pathways in cancer Viral carcinogenesis Viral myocarditis Lipid and atherosclerosis		Apoptotic cleavage of cellular proteins Caspase activation via Death Receptors in the presence of ligand NOD1/2 Signaling Pathway TRIF-mediated programmed cell death Caspase-mediated cleavage of cytoskeletal proteins Regulation by c-FLIP RIPK1-mediated regulated necrosis CASP8 activity is inhibited TNFR1-induced proapoptotic signaling Regulation of TNFR1 signaling CLEC7A/inflammasome pathway Regulation of necroptotic cell death Dimerization of procaspase-8 Activation, myristolyation of BID and translocation to mitochondria Apoptotic execution phase FasL/ CD95L signaling TRAIL signaling TLR3-mediated TICAM1-dependent programmed cell death NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10

317

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autoimmune lymphoproliferative syndrome type 2B	Likely pathogenic; Pathogenic	rs373232880, rs1457092267, rs1948252170, rs1559374786, rs2470005907, rs143410219, rs762135470, rs2470081765, rs17860424, rs2470084250, rs2470003978, rs758051022, rs760132764, rs747862347, rs777784105, rs765672355, rs1368296717 View all (2 more)	RCV001379656 RCV001898605 RCV002040866 RCV002632653 RCV002638923 RCV002890277 RCV002967234 RCV003052336 RCV000008201 RCV003510173 RCV003620040 RCV003619487 RCV003619638 RCV000778584 RCV001216905 RCV001243840 RCV001267745
Hepatocellular carcinoma	Pathogenic	rs587776665	RCV000008202
Lung cancer	Likely pathogenic	rs1559356254	RCV003990653

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
BREAST CANCER, PROTECTION AGAINST	Benign	rs1045485	RCV000008203
CASP8-related disorder	Uncertain significance; Likely benign; Benign	rs149933993, rs140527175, rs971778876, rs35976359	RCV003401353 RCV003911493 RCV003913961 RCV004753153
Cervical cancer	Benign	rs17860432	RCV005896051
Familial cancer of breast	Benign; Likely benign; Uncertain significance	rs17860422, rs200261147	RCV002504124 RCV003224393
Familial pancreatic carcinoma	Benign	rs17860432	RCV005896052
Lung cancer, protection against	protective	rs3834129	RCV000008204
Malignant tumor of urinary bladder	Uncertain significance	rs931648756	RCV005931571
Ovarian serous cystadenocarcinoma	Uncertain significance	rs758971363	RCV005913627
Sarcoma	Benign	rs17860432	RCV005896053
Thymoma	Benign	rs17860432	RCV005896054

Show/Hide Text Mining Associations (235)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	11861282
Adenocarcinoma	Associate	22199128, 22843554
Adenocarcinoma of Lung	Associate	16052233, 23470529, 27706758, 28278082, 33985619, 35866781
Adenoma Islet Cell	Associate	28314692
Adenoma Pleomorphic	Associate	23510689
Alzheimer Disease	Associate	26939933, 28558704, 28985224
Aneuploidy	Inhibit	27592797
Anterior Cruciate Ligament Injuries	Associate	31692049
Anthracosis	Associate	34982434
Anus Neoplasms	Associate	27325299, 27462786
Arthritis Juvenile	Associate	34963488
Arthritis Psoriatic	Associate	34576119
Arthritis Rheumatoid	Associate	10817565, 24452947
Asthma	Associate	18823309
Astrocytoma	Associate	15112054
Atrial Fibrillation	Associate	33834070
Autoimmune Diseases	Associate	25569260
Autoimmune Lymphoproliferative Syndrome	Associate	25814141, 31309545, 33995372
Barth Syndrome	Associate	23523468
Behcet Syndrome	Associate	15986355
Brain Neoplasms	Associate	18398042, 26163602
Breast Neoplasms	Associate	14701762, 14993214, 18362937, 19318553, 19843670, 20033885, 20154269, 20978178, 21127496, 21194473, 21596841, 21901386, 22532573, 23544014, 23593120 View all (31 more)
Breast Neoplasms	Stimulate	19094228
Breast Neoplasms	Inhibit	20132554, 20978178, 39351539, 39391306
Burkitt Lymphoma	Associate	10477698, 10946276
Calcinosis Cutis	Associate	21513580, 35022419
Carcinogenesis	Associate	16443735, 17726263, 27798717, 33749640, 35325509, 36580018
Carcinoid Tumor	Associate	12170765
Carcinoid Tumor	Inhibit	26008974
Carcinoma	Associate	23659359, 24149212
Carcinoma Basal Cell	Associate	24927175, 25855136, 26740556
Carcinoma Hepatocellular	Associate	11572758, 12748179, 16627981, 16750275, 18161048, 20398055, 23443079, 24209510, 25543761, 25755779, 28246474, 28350813, 28534955, 29476051, 30021196 View all (4 more)
Carcinoma Non Small Cell Lung	Associate	12170765, 22843554, 23254292, 23470529, 32705266, 36047776
Carcinoma Ovarian Epithelial	Associate	17569106, 24690311
Carcinoma Renal Cell	Associate	19940360, 20442297, 28154184, 36647955
Carcinoma Squamous Cell	Associate	25303977, 26107208, 27462786, 29617660, 35894839, 39694330
Cardiomyopathy Dilated	Associate	25888309
Carpal Tunnel Syndrome	Associate	31692049
Celiac Disease	Stimulate	37455655
Cell Transformation Neoplastic	Inhibit	19706414
Central Nervous System Infections	Associate	37678673
Chagas Cardiomyopathy	Associate	17160263
Cholangiocarcinoma	Associate	28662515
Chondrosarcoma	Associate	28522217
Choriocarcinoma	Associate	16443735
Colitis Ulcerative	Associate	36576886
Colonic Neoplasms	Associate	24317430
Colorectal Neoplasms	Associate	16036110, 16217767, 16619028, 17436592, 20567954, 20570920, 21722370, 23615374, 23844036, 24465592, 24498403, 24842234, 24934366, 26180579, 27507139 View all (11 more)
Colorectal Neoplasms	Stimulate	32552466
Communication Disorders	Associate	36829233
COVID 19	Associate	33029094, 35855804, 36708447, 36829233, 36966617
COVID 19	Stimulate	36443881
Coxa Magna	Associate	38204239
Cranial Nerve Diseases	Associate	25814141
Craniosynostoses	Stimulate	29847820
Cryopyrin Associated Periodic Syndromes	Associate	35716229
Death	Associate	11279061, 20332233, 25950471, 29663074, 37016353
Developmental Disabilities	Associate	29301000
Diabetes Mellitus	Associate	23335850, 28127871
Diabetes Mellitus	Stimulate	31587010
Diabetes Mellitus Type 2	Associate	37957232
Diabetic Nephropathies	Associate	35932042
DNA Virus Infections	Stimulate	12690107
Drug Related Side Effects and Adverse Reactions	Associate	10891490, 18603276, 20138029, 22040089, 22843554, 28278082
Drug Related Side Effects and Adverse Reactions	Stimulate	15130948, 19684859
Endodermal Sinus Tumor	Associate	21712824
Endometrial Neoplasms	Associate	16014121, 16928264, 19531679, 28421904, 32407273
Epilepsy Post Traumatic	Inhibit	38557165
Esophageal Neoplasms	Associate	26635288, 28542283, 36533709
Esophageal Squamous Cell Carcinoma	Associate	17187659, 21926110, 24819879, 25431829, 33457096
Fatty Liver	Associate	37957232
Fatty Liver Alcoholic	Associate	30248539
Fever	Stimulate	34066632
Fibrocartilaginous embolism	Associate	32196619
Frailty	Associate	39464190
Gallbladder Neoplasms	Associate	21283657
Glioblastoma	Associate	15523899, 18812519, 19432816, 22585859, 22672670, 24213561, 24561085, 25226230, 26017671, 27927008, 28594322, 30385739, 30670698, 36460775
Glioma	Associate	12496285, 14655759, 15523899, 16080161, 16319070, 18239851, 18398042, 21364665, 25755779, 26470725, 31806377, 35296768, 36325335, 36466844
Gout	Associate	36291136
Granuloma	Associate	25814141
Granulomatous Disease Chronic	Associate	26283340
Graves Disease	Associate	12930371, 18324486
Hashimoto Disease	Associate	12930371, 18324486
Head and Neck Neoplasms	Associate	25314064, 28749946
Heart Arrest	Associate	36930329
Heart Failure	Associate	29847820
Hematologic Diseases	Associate	22843554
Hemochromatosis	Associate	18563783
Hemolytic Uremic Syndrome	Associate	40149873
Hepatitis C	Stimulate	23256595
Hepatitis C Chronic	Associate	32050950
Hereditary Autoinflammatory Diseases	Associate	35716229
Hereditary Breast and Ovarian Cancer Syndrome	Associate	10574243, 20978178
Heredodegenerative Disorders Nervous System	Associate	25814141
Herpes Simplex	Associate	29717769
HIV Infections	Associate	11861282, 30344003, 30653393
Hypertension	Stimulate	17558734
Hyperuricemia	Stimulate	29780394
Hypothermia	Inhibit	19596001
Hypoxia	Inhibit	17600131, 36748372
Hypoxia	Associate	19706414, 20653473, 23492767, 26464645
Hypoxia Brain	Stimulate	15613236
Idiopathic Interstitial Pneumonias	Associate	12480919
Immune System Diseases	Associate	25814141
Infections	Stimulate	33207682, 37227036
Infections	Inhibit	40302074
Inflammation	Associate	20178593, 20653473, 24934366, 28985224, 29780394, 35894839, 36460775, 36647737, 38007509, 40133606, 40149873
Inflammatory Bowel Diseases	Associate	36647737
Inflammatory Breast Neoplasms	Associate	30086764
Influenza Human	Associate	24641803
Ischemia	Inhibit	33000275
Kidney Neoplasms	Associate	33828176
Lead Poisoning Nervous System	Associate	38146363
Leprosy	Associate	26367014, 29593724
Leukemia	Associate	11238127, 11514566, 12506034, 17561974, 17993614, 19182209, 19298651, 20105315, 21190589, 26692089
Leukemia Large Granular Lymphocytic	Associate	17993614
Leukemia Lymphocytic Chronic B Cell	Associate	11675354, 12351409, 12649137, 15914559, 20628148
Leukemia Lymphoma Adult T Cell	Associate	11472346, 31594868
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34673425
Leukemia Myeloid Acute	Stimulate	19298651
Leukemia Myeloid Acute	Associate	24526787, 35873796
Leukemia Promyelocytic Acute	Associate	12899712, 30551620
Leukemic Infiltration	Associate	25814141
Leukoplakia	Associate	32492030, 35358331, 35894839
Liver Diseases Alcoholic	Associate	38146363
Liver Failure	Associate	12393901
Lung Neoplasms	Inhibit	12170765, 27927008
Lung Neoplasms	Associate	20661084, 21435100, 21525012, 28099148, 28542283, 29165042, 32069989
Lupus Erythematosus Systemic	Associate	15703453
Lymphatic Metastasis	Associate	23358467, 36533709
Lymphatic Metastasis	Stimulate	28700659
Lymphoma B Cell	Associate	11222383, 15009062, 20159985, 24039967
Lymphoma Extranodal NK T Cell	Associate	31908105
Lymphoma Follicular	Associate	14614322
Lymphoma Large Cell Anaplastic	Associate	17308066
Lymphoma Non Hodgkin	Associate	10468853, 19414860, 23844036, 36580018
Lymphoma Non Hodgkin	Stimulate	19298651
Lymphoma Non Hodgkin	Inhibit	36580018
Lymphoma Primary Effusion	Associate	36801923
Lymphoma T Cell	Associate	37160920
Lymphoma T Cell Cutaneous	Associate	17495957, 22011910, 26302991, 30167641
Lysosomal Storage Diseases	Associate	17056595
Malformations of Cortical Development Group I	Associate	12522004, 19557855, 24809452, 26025363, 28638870, 29070760
Malformations of Cortical Development Group I	Stimulate	18448526
Measles	Associate	29717769
Medulloblastoma	Associate	15029256, 18342014
Melanoma	Associate	11067917, 16520380, 18222423, 20461078, 21983787, 23527236, 35357426
Melanoma Cutaneous Malignant	Associate	18563783
Michelin tire baby syndrome	Associate	29301000
Mitochondrial Diseases	Associate	17056595, 20404718
Mouth Neoplasms	Associate	19479204, 24337492, 25631445, 27827950, 29037125, 31280204, 32492030, 33108350, 34167951, 39327561
Multiple Myeloma	Associate	11877293, 12531793, 12969976, 15070698, 16487170, 17384201, 17910628, 22420897, 27738323, 28264449, 28270494, 29562955, 30115673, 36262053
Multiple Myeloma	Inhibit	12393500
Multiple Sclerosis Chronic Progressive	Associate	29780394
Multiple Sclerosis Relapsing Remitting	Associate	29780394
Muscle Hypotonia	Stimulate	24475260
Muscle Hypotonia	Associate	29301000
Muscular Atrophy Spinal	Associate	22723941
Musculoskeletal Diseases	Associate	31692049
Myelodysplastic Syndromes	Associate	15677568
Myocardial Infarction	Associate	35229543, 35757636
Nasopharyngeal Carcinoma	Associate	31566021, 31991751
Necrosis	Associate	25906152
Neonatal herpes	Inhibit	25005804
Neonatal herpes	Associate	26458812
Neoplasm Metastasis	Associate	22493319, 27462786, 28429358
Neoplasms	Associate	10706869, 10946322, 11279061, 11472346, 12432271, 12433278, 12499637, 12556444, 12954616, 14522966, 15029256, 17064406, 17203870, 18362937, 18381704 View all (82 more)
Neoplasms	Inhibit	16080161, 19258216, 24252461, 28594322, 29233452, 34638912, 36433652
Neoplasms	Stimulate	27323411, 31239343
Nerve Degeneration	Associate	19176810
Neural crest tumor	Associate	15029256
Neuroblastoma	Associate	12170765, 12771917, 12841868, 14670183, 15029256, 15632181, 16886176, 16930472, 17064406, 17962944, 18342014, 18794122, 19924290, 20546602, 22493319 View all (6 more)
Neuroblastoma	Inhibit	16979248
Neurodegenerative Diseases	Associate	19176810, 28985224
Neurotoxicity Syndromes	Associate	28985224
Neutropenia	Associate	28278082
Niemann Pick Disease Type C	Associate	26942880
NOG Related Symphalangism Spectrum Disorder	Associate	12651606
Non alcoholic Fatty Liver Disease	Associate	37957232
Obesity	Associate	39464190
Oculocutaneous albinism type 2	Associate	34982434
Osteoarthritis	Associate	10088775, 31762289, 40165317
Osteosarcoma	Associate	28002586, 28109080
Ovarian Neoplasms	Associate	18431743, 19415457, 19959214, 20978178, 21487429, 22558117, 22843880, 23826964, 30197345, 30941888, 31424650, 31702036, 37120633
Pancreatic Neoplasms	Associate	17410536, 19843670, 27756327, 32504778, 36882663
Parkinson Disease	Associate	19176810
Penile Induration	Associate	23356197
Periodontitis	Associate	19309556
Philadelphia Chromosome	Associate	29542026
Pneumothorax	Stimulate	20653473
Polyposis Syndrome Hereditary Mixed 1	Stimulate	17726263
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	16225771
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17378240
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	17054427
Primary Immunodeficiency Diseases	Associate	38644452
Progeria	Associate	24475260
Prostatic Intraepithelial Neoplasia	Associate	17203870
Prostatic Neoplasms	Associate	17203870, 20053773, 26740556, 27197191, 28855498, 34482382
Prostatic Neoplasms	Stimulate	33828176
Prostatitis	Associate	20033885
Pulmonary Edema	Stimulate	26617708
Purpura Thrombotic Thrombocytopenic	Associate	18339897, 31714957
Reperfusion Injury	Stimulate	19596001
Retinal Dysplasia	Associate	17187659
Ring Chromosome 20 Syndrome	Stimulate	38102696
Rotator Cuff Injuries	Associate	31692049
Rufous oculocutaneous albinism	Associate	34982434
Sarcoma	Associate	12919886
Scleroderma Systemic	Associate	15703453
Sepsis	Associate	36443881
Silicosis	Associate	15703453
Sleep Deprivation	Associate	30551620
Small Cell Lung Carcinoma	Associate	12170765, 26988918
Small Cell Lung Carcinoma	Inhibit	18342014
Squamous Cell Carcinoma of Head and Neck	Associate	20086182, 20808443, 21801448, 23358467, 23619168, 23659359, 24292195, 25275298, 26107208, 27323410, 27644244, 27693639, 28435450, 28700659, 29053175 View all (12 more)
Squamous Intraepithelial Lesions	Stimulate	21436691
Status Asthmaticus	Associate	18823309
Stomach Diseases	Associate	30019295
Stomach Neoplasms	Associate	12174360, 12439910, 23921907, 24509146, 28000850, 28429358, 28972304, 36748372
Tendinopathy	Associate	31692049
Thrombocythemia Essential	Associate	29542026
Thrombocytopenia	Associate	28278082
Thyroid Cancer Papillary	Associate	32182833
Thyroid Neoplasms	Associate	16452205, 35546566, 35968508
Thyroiditis Autoimmune	Associate	18324486
Tongue Neoplasms	Associate	19414420
Toxoplasmosis	Associate	29717769
Triple Negative Breast Neoplasms	Associate	24325915, 27476169, 29374147, 29663486, 34036395, 35056723, 37175458
Trophoblastic Neoplasms	Associate	16443735
Tuberculosis Central Nervous System	Associate	21569377
Urinary Bladder Neoplasms	Associate	29739919
Uterine Cervical Neoplasms	Associate	15197583, 19258216, 26458812, 28112728, 33096476, 36399280, 38555994, 39707317, 40603406
Uterine Cervicitis	Associate	21436691
Virus Diseases	Associate	33029094
Wilms Tumor	Associate	14735202, 35436013

CASP8 (caspase 8)