SPARCL1 (SPARC like 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 8404
Gene name SPARC like 1
Gene symbol SPARCL1
Synonyms (NCBI Gene)
MAST 9MAST9PIG33SC1
Chromosome 4
Chromosome location 4q22.1
miRNA miRNA information provided by mirtarbase database.
12
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (12)
miRTarBase ID miRNA Experiments Reference
MIRT027605 hsa-miR-98-5p Microarray 19088304
MIRT755960 hsa-miR-1290 Luciferase reporter assayWestern blottingqRT-PCRRNA pull down assay 35549806
MIRT1381922 hsa-miR-101 CLIP-seq
MIRT1381923 hsa-miR-144 CLIP-seq
MIRT1381924 hsa-miR-153 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (16)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 20926826
GO:0005518 Function Collagen binding IBA
GO:0005576 Component Extracellular region HDA 27068509
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606041 11220 ENSG00000152583
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14515
Protein name SPARC-like protein 1 (High endothelial venule protein) (Hevin) (MAST 9)
PDB 7KBU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09289 FOLN 433 → 454 Follistatin/Osteonectin-like EGF domain Domain
PF00050 Kazal_1 456 → 509 Kazal-type serine protease inhibitor domain Domain
PF10591 SPARC_Ca_bdg 512 → 650 Secreted protein acidic and rich in cysteine Ca binding region Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lymph node, brain, heart, lung, skeletal muscle, ovary, small intestine, and colon, with lower levels in placenta, pancreas, testis, spleen, and thymus, and no expression in kidney, liver, and peripheral blood leuko
Sequence 
MKTGLFFLCLLGTAAAIPTNARLLSDHSKPTAETVAPDNTAIPSLRAEAEENEKETAVST
EDDSHHKAEKSSVLKSKEESHEQSAEQGKSSSQELGLKDQEDSDGHLSVNLEYAPTEGTL
DIKEDMSEPQEKKLSENTDFLAPGVSSFTDSNQQESITKREENQEQPRNYSHHQLNRSSK
HSQGLRDQGNQEQDPNISNGEEEEEKEPGEVGTHNDNQERKTELPREHANSKQEEDNTQS
DDILEESDQPTQVSKMQEDEFDQGNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT
GLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGTDGPRHSASDD
YFIPSQAFLEAERAQSIAYHLKIEEQREKVHENENIGTTEPGEHQEAKKAENSSNEEETS
SEGNMRVHAVDSCMSFQCKRGHICKADQQGKPHCVCQDPVTCPPTKPLDQVCGTDNQTYA
SSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPLRMRDWLKNILMQLYE
ANSEHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELD
QHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDE
NLLF
Sequence length 664
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Uncertain significance rs41282397 RCV005932192
Ovarian serous cystadenocarcinoma Uncertain significance rs41282397 RCV005932193
SPARCL1-related disorder Uncertain significance rs1292178655, rs1724503244, rs2475931498 RCV003410464
RCV003408343
RCV003393121
Show/Hide Text Mining Associations (46)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 24921089
Adenocarcinoma of Lung Inhibit 28178989
Alzheimer Disease Associate 29154276, 40471493
Amyotrophic Lateral Sclerosis Associate 26401960
Breast Neoplasms Inhibit 23534723
Breast Neoplasms Associate 37180578
Carcinogenesis Associate 23534723
Carcinoma Hepatocellular Associate 34238253
Carcinoma Ovarian Epithelial Associate 30964161
Carcinoma Pancreatic Ductal Stimulate 17325739