Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83987
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil domain containing 8 subunit of 3M complex
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCDC8
Synonyms (NCBI Gene) Gene synonyms aliases
3M3, PPP1R20, p90
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a cofactor required for p53-mediated apoptosis following DNA damage, and may also play a role in growth through interactions with the cytoskeletal adaptor protein
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs752254407 ->C Pathogenic Frameshift variant, coding sequence variant
rs1568590155 ->A Pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT044884 hsa-miR-193a-3p CLASH 23622248
MIRT869892 hsa-miR-10a CLIP-seq
MIRT869893 hsa-miR-10b CLIP-seq
MIRT869894 hsa-miR-1285 CLIP-seq
MIRT869895 hsa-miR-1304 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IBA
GO:0000226 Process Microtubule cytoskeleton organization IMP 24793695
GO:0005515 Function Protein binding IPI 25752541
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA 24793695
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614145 25367 ENSG00000169515
Protein
UniProt ID Q9H0W5
Protein name Coiled-coil domain-containing protein 8
Protein function Core component of the 3M complex, a complex required to regulate microtubule dynamics and genome integrity. It is unclear how the 3M complex regulates microtubules, it could act by controlling the level of a microtubule stabilizer (PubMed:247936
PDB 4LG6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14893 PNMA 1 116 PNMA Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with low levels in spleen, skeletal muscle, small intestine, kidney and liver. {ECO:0000269|PubMed:21737058}.
Sequence
MLQIGEDVDYLLIPREVRLAGGVWRVISKPATKEAEFRERLTQFLEEEGRTLEDVARIME
KSTPHPPQPPKKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDK
SRQG
PRRGKKVRKMPVSYLGSKFLGSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMF
EDNLGPQLSKADRWREYVSQVSWGKLKRRVKGWAPRAGPGVGEARLASTAVESAGVSSAP
EGTSPGDRLGNAGDVCVPQASPRRWRPKINWASFRRRRKEQTAPTGQGADIEADQGGEAA
DSQREEAIADQREGAAGNQRAGAPADQGAEAADNQREEAADNQRAGAPAEEGAEAADNQR
EEAADNQRAEAPADQRSQGTDNHREEAADNQRAEAPADQGSEVTDNQREEAVHDQRERAP
AVQGADNQRAQARAGQRAEAAHNQRAGAPGIQEAEVSAAQGTTGTAPGARARKQVKTVRF
QTPGRFSWFCKRRRAFWHTPRLPTLPKRVPRAGEARNLRVLRAEARAEAEQGEQEDQL
Sequence length 538
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
3M syndrome 3M syndrome 3 rs752254407, rs1568590155 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
immunodeficiency Immunodeficiency N/A N/A ClinVar
Spinocerebellar Ataxia spinocerebellar ataxia type 40 N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Biliary Atresia Associate 36350824
Breast Neoplasms Associate 38235137
Carcinoma Hepatocellular Associate 28700999
Carcinoma Renal Cell Associate 34569727
Glioma Associate 19544381
Growth Disorders Associate 24711643, 24793695, 25752541, 28675896
Laron Syndrome Associate 34136918
Miller McKusick Malvaux Syndrome (3M Syndrome) Associate 21737058, 23517720, 24711643, 25752541, 28675896, 32141654, 33107243, 34136918, 37877343
Musculoskeletal Abnormalities Associate 25752541
Neoplasms Associate 19544381