Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83959
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 4 member 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC4A11
Synonyms (NCBI Gene) Gene synonyms aliases
BTR1, CDPD1, CHED, CHED2, NABC1, dJ794I6.2
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20p13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a voltage-regulated, electrogenic sodium-coupled borate cotransporter that is essential for borate homeostasis, cell growth and cell proliferation. Mutations in this gene have been associated with a number of endothelial corneal dystroph
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121909387 C>T Pathogenic Coding sequence variant, non coding transcript variant, genic downstream transcript variant, missense variant
rs121909388 G>A Pathogenic Coding sequence variant, genic downstream transcript variant, downstream transcript variant, non coding transcript variant, missense variant
rs121909389 C>T Pathogenic Coding sequence variant, non coding transcript variant, 3 prime UTR variant, missense variant
rs121909390 G>A,C Pathogenic Coding sequence variant, genic downstream transcript variant, synonymous variant, stop gained, non coding transcript variant, missense variant
rs121909391 G>A Pathogenic Coding sequence variant, non coding transcript variant, genic downstream transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1364874 hsa-miR-210 CLIP-seq
MIRT1364875 hsa-miR-338-3p CLIP-seq
MIRT1364876 hsa-miR-4530 CLIP-seq
MIRT1364877 hsa-miR-4684-5p CLIP-seq
MIRT2626667 hsa-miR-1228 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005272 Function Sodium channel activity IDA 15525507
GO:0005372 Function Water transmembrane transporter activity IDA 23813972, 31273259
GO:0005452 Function Solute:inorganic anion antiporter activity IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610206 16438 ENSG00000088836
Protein
UniProt ID Q8NBS3
Protein name Solute carrier family 4 member 11 (Sodium borate cotransporter 1) (NaBC1)
Protein function Multifunctional transporter with an impact in cell morphology and differentiation. In the presence of borate B(OH)4(-), acts as a voltage-dependent electrogenic Na(+)-coupled B(OH)4(-) cotransporter controlling boron homeostasis (PubMed:15525507
PDB 7X1G , 7X1H , 7X1I , 7X1J
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00955 HCO3_cotransp 336 835 HCO3- transporter family Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in kidney, testis, salivary gland, thyroid, trachea and corneal endothelium. Not detected in retina and lymphocytes. {ECO:0000269|PubMed:11302728, ECO:0000269|PubMed:16767101}.; TISSUE SPECIFICITY: [I
Sequence
MSQVGGRGDRCTQEVQGLVHGAGDLSASLAENSPTMSQNGYFEDSSYYKCDTDDTFEARE
EILGDEAFDTANSSIVSGESIRFFVNVNLEMQATNTENEATSGGCVLLHTSRKYLKLKNF
KEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLF
TDAGAPMRGKVHLLSDTIQGVTATVTGVRYQQSWLCIICTMKALQKRHVCISRLVRPQNW
GENSCEVRFVILVLAPPKMKSTKTAMEVARTFATMFSDIAFRQKLLETRTEEEFKEALVH
QRQLLTMVSHGPVAPRTKERSTVSLPAHRHPEPPKCKDFVPFGKGIREDIARRFPLYPLD
FTDGIIGKNKAVGKYITTTLFLYFACLLPTIAFGSLNDENTDGAIDVQKTIAGQSIGGLL
YALFSGQPLVILLTTAPLALYIQVIRVICDDYDLDFNSFYAWTGLWNSFFLALYAFFNLS
LVMSLFKRSTEEIIALFISITFVLDAVKGTVKIFWKYYYGHYLDDYHTKRTSSLVSLSGL
GASLNASLHTALNASFLASPTELPSATHSGQATAVLSLLIMLGTLWLGYTLYQFKKSPYL
HPCVREILSDCALPIAVLAFSLISSHGFREIEMSKFRYNPSESPFAMAQIQSLSLRAVSG
AMGLGFLLSMLFFIEQNLVAALVNAPENRLVKGTAYHWDLLLLAIINTGLSLFGLPWIHA
AYPHSPLHVRALALVEERVENGHIYDTIVNVKETRLTSLGASVLVGLSLLLLPVPLQWIP
KPVLYGLFLYIALTSLDGNQLVQRVALLLKEQTAYPPTHYIRRVPQRKIHYFTGL
QVLQL
LLLCAFGMSSLPYMKMIFPLIMIAMIPIRYILLPRIIEAKYLDVMDAEHRP
Sequence length 891
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Corneal Dystrophy-Perceptive Deafness Syndrome corneal dystrophy-perceptive deafness syndrome rs1191074716, rs869320721, rs1430176022, rs869320722, rs121909393, rs121909396, rs121909394, rs121909395, rs757553189, rs121909388, rs1363770105, rs121909390 N/A
Corneal Endothelial Dystrophy corneal dystrophy, fuchs endothelial, 4 rs267607064, rs1600618680 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Congenital Hereditary Endothelial Dystrophy congenital hereditary endothelial dystrophy of cornea N/A N/A GenCC
Corneal Dystrophy corneal dystrophy, Fuchs' endothelial dystrophy N/A N/A ClinVar, GenCC
Polymorphous corneal dystrophy Posterior polymorphous corneal dystrophy 1 N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 31556319
Corneal Diseases Associate 25394471, 27581649
Corneal Dystrophies Hereditary Associate 11836359, 17220209, 20848555, 24351571, 31273259, 36902444
Corneal dystrophy and perceptive deafness Associate 11836359, 17220209, 20848555, 24351571, 25394471, 27581649
Corneal Dystrophy Fuchs Endothelial 4 Associate 38252645
Corneal dystrophy Fuchs' endothelial 1 Associate 25394471
Corneal Dystrophy Posterior Polymorphous 1 Associate 26619383
Corneal Edema Associate 38252645
Corneal Endothelial Cell Loss Associate 27581649, 38252645
Corneal endothelial dystrophy type 2 Associate 16825429, 17220209, 17262014, 20848555, 21203343, 24351571, 25394471, 26286922, 26619383, 27581649, 27609159, 28642546, 31273259, 31323090, 36037197
View all (5 more)