FCAMR (Fc alpha and mu receptor)

Gene

• Entrez ID: 83953
• Gene name: Fc alpha and mu receptor
• Gene symbol: FCAMR
• Synonyms (NCBI Gene): CD351, FCA/MR, FKSG87, Fcalpha/muR
• Chromosome: 1
• Chromosome location: 1q32.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT449393	hsa-miR-376b-5p	PAR-CLIP	22100165
MIRT449392	hsa-miR-376c-5p	PAR-CLIP	22100165
MIRT449391	hsa-miR-155-5p	PAR-CLIP	22100165
MIRT449390	hsa-miR-1273e	PAR-CLIP	22100165
MIRT449388	hsa-miR-4804-5p	PAR-CLIP	22100165
MIRT449389	hsa-miR-1261	PAR-CLIP	22100165
MIRT449393	hsa-miR-376b-5p	PAR-CLIP	22100165
MIRT449392	hsa-miR-376c-5p	PAR-CLIP	22100165
MIRT449391	hsa-miR-155-5p	PAR-CLIP	22100165
MIRT449390	hsa-miR-1273e	PAR-CLIP	22100165
MIRT449388	hsa-miR-4804-5p	PAR-CLIP	22100165
MIRT449389	hsa-miR-1261	PAR-CLIP	22100165
MIRT993674	hsa-miR-1236	CLIP-seq
MIRT993675	hsa-miR-1260	CLIP-seq
MIRT993676	hsa-miR-1260b	CLIP-seq
MIRT993677	hsa-miR-188-3p	CLIP-seq
MIRT993678	hsa-miR-3156-3p	CLIP-seq
MIRT993679	hsa-miR-3692	CLIP-seq
MIRT993680	hsa-miR-4476	CLIP-seq
MIRT993681	hsa-miR-4533	CLIP-seq
MIRT993682	hsa-miR-4711-5p	CLIP-seq
MIRT993683	hsa-miR-4753-3p	CLIP-seq
MIRT993684	hsa-miR-509-3p	CLIP-seq
MIRT993685	hsa-miR-552	CLIP-seq
MIRT993686	hsa-miR-668	CLIP-seq
MIRT993687	hsa-miR-671-5p	CLIP-seq
MIRT993688	hsa-miR-765	CLIP-seq
MIRT993689	hsa-miR-942	CLIP-seq
MIRT2449578	hsa-miR-296-5p	CLIP-seq
MIRT2449579	hsa-miR-3136-3p	CLIP-seq
MIRT2449580	hsa-miR-3194-5p	CLIP-seq
MIRT2449581	hsa-miR-635	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IBA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 605484
• HGNC: 24692
• e!Ensembl: ENSG00000162897

Protein

• UniProt ID: Q8WWV6
• Protein name: High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor (Fc alpha/mu receptor) (CD antigen CD351)
• Protein function: Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	65 → 171	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by mesangial cells. {ECO:0000269|PubMed:11779189}.
• Sequence:

  MPLFLILCLLQGSSFALPQKRPHPRWLWEGSLPSRTHLRAMGTLRPSSPLCWREESSFAA
  PNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHR
  YRDRVALTDFPQRGLFVVRLSQLSPDDIGCYLCGIGSENNMLFLSMNLTISAGPASTLPT
  ATPAAGELTMRSYGTASPVANRWTPGTTQTLGQGTAWDTVASTPGTSKTTASAEGRRTPG
  ATRPAAPGTGSWAEGSVKAPAPIPESPPSKSRSMSNTTEGVWEGTRSSVTNRARASKDRR
  EMTTTKADRPREDIEGVRIALDAAKKVLGTIGPPALVSETLAWEILPQATPVSKQQSQGS
  IGETTPAAGMWTLGTPAADVWILGTPAADVWTSMEAASGEGSAAGDLDAATGDRGPQATL
  SQTPAVGPWGPPGKESSVKRTFPEDESSSRTLAPVSTMLALFMLMALVLLQRKLWRRRTS
  QEAERVTLIQMTHFLEVNPQADQLPHVERKMLQDDSLPAGASLTAPERNPGP

• Sequence length: 532

Pathways

Reactome:

Cell surface interactions at the vascular wall

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinoma Squamous Cell	Associate	34887858	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	28355232	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	28355232	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Associate	26138065	★☆☆☆☆ Found in Text Mining only