Gene Gene information from NCBI Gene database.
Entrez ID 8395
Gene name Phosphatidylinositol-4-phosphate 5-kinase type 1 beta
Gene symbol PIP5K1B
Synonyms (NCBI Gene)
MSS4STM7
Chromosome 9
Chromosome location 9q21.11
miRNA miRNA information provided by mirtarbase database.
36
miRTarBase ID miRNA Experiments Reference
MIRT2069424 hsa-miR-1206 CLIP-seq
MIRT2069425 hsa-miR-128 CLIP-seq
MIRT2069426 hsa-miR-27a CLIP-seq
MIRT2069427 hsa-miR-27b CLIP-seq
MIRT2069428 hsa-miR-412 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000285 Function 1-phosphatidylinositol-3-phosphate 5-kinase activity TAS
GO:0001931 Component Uropod IDA 20442317
GO:0005515 Function Protein binding IPI 20442317
GO:0005524 Function ATP binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602745 8995 ENSG00000107242
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14986
Protein name Phosphatidylinositol 4-phosphate 5-kinase type-1 beta (PIP5K1-beta) (PtdIns(4)P-5-kinase 1 beta) (EC 2.7.1.68) (Phosphatidylinositol 4-phosphate 5-kinase type I beta) (PIP5KIbeta) (Protein STM-7) (Type I phosphatidylinositol 4-phosphate 5-kinase beta)
Protein function Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns(4)P/PI4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2/PIP2), a lipid second messenger that regulates several cellular processes such as signal transductio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01504 PIP5K 110 394 Phosphatidylinositol-4-phosphate 5-Kinase Family
Tissue specificity TISSUE SPECIFICITY: Detected in heart, pancreas, brain, kidney, skeletal muscle and lung. {ECO:0000269|PubMed:8955136}.
Sequence
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETPQNVPDAKRTGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSR
VFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYPHDRPTLYSNSKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL
Sequence length 540
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Phospholipase D signaling pathway
Endocytosis
Focal adhesion
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Yersinia infection
Choline metabolism in cancer
  Synthesis of PIPs at the plasma membrane
WNT mediated activation of DVL
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Malignant lymphoma, large B-cell, diffuse Uncertain significance rs748320210 RCV005939393
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 26840709
Adenoma Stimulate 35260162
Disorders of Sex Development Stimulate 24055526
Gonadal Dysgenesis 46 XY Associate 24055526
Hodgkin Disease Associate 30347596
Renal Insufficiency Chronic Associate 20383146, 29016630
Tuberculosis Multidrug Resistant Associate 30347596