Gene Gene information from NCBI Gene database.
Entrez ID 83939
Gene name Eukaryotic translation initiation factor 2A
Gene symbol EIF2A
Synonyms (NCBI Gene)
CDA02EIF-2AMST089MSTP004MSTP089
Chromosome 3
Chromosome location 3q25.1
Summary This gene encodes a eukaryotic translation initiation factor that catalyzes the formation of puromycin-sensitive 80 S preinitiation complexes and the poly(U)-directed synthesis of polyphenylalanine at low concentrations of Mg2+. This gene should not be co
miRNA miRNA information provided by mirtarbase database.
265
miRTarBase ID miRNA Experiments Reference
MIRT031752 hsa-miR-16-5p Proteomics 18668040
MIRT048013 hsa-miR-30c-5p CLASH 23622248
MIRT044991 hsa-miR-186-5p CLASH 23622248
MIRT678090 hsa-miR-6813-3p HITS-CLIP 23824327
MIRT678089 hsa-miR-125a-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000049 Function TRNA binding IBA
GO:0000049 Function TRNA binding IMP 12133843
GO:0003729 Function MRNA binding IBA
GO:0003743 Function Translation initiation factor activity IBA
GO:0003743 Function Translation initiation factor activity IDA 10563826
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609234 3254 ENSG00000144895
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BY44
Protein name Eukaryotic translation initiation factor 2A (eIF-2A) (65 kDa eukaryotic translation initiation factor 2A) [Cleaved into: Eukaryotic translation initiation factor 2A, N-terminally processed]
Protein function Functions in the early steps of protein synthesis of a small number of specific mRNAs. Acts by directing the binding of methionyl-tRNAi to 40S ribosomal subunits. In contrast to the eIF-2 complex, it binds methionyl-tRNAi to 40S subunits in a co
PDB 8DYS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08662 eIF2A 216 411 Eukaryotic translation initiation factor eIF2A Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in pancreas, heart, brain and placenta. {ECO:0000269|PubMed:12133843}.
Sequence
MAPSTPLLTVRGSEGLYMVNGPPHFTESTVFPRESGKNCKVCIFSKDGTLFAWGNGEKVN
IISVTNKGLLHSFDLLKAVCLEFSPKNTVLATWQPYTTSKDGTAGIPNLQLYDVKTGTCL
KSFIQKKMQNWCPSWSEDETLCARNVNNEVHFFENNNFNTIANKLHLQKINDFVLSPGPQ
PYKVAVYVPGSKGAPSFVRLYQYPNFAGPHAALANKSFFKADKVTMLWNKKATAVLVIAS
TDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKAT
IFNLKCDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLRGQMEVWDVKNYKLISKPVASDS
TYFAWCPDGEHILTATCAPRLRVNNGYKIWHYTGSILHKYDVPSNAELWQV
SWQPFLDGI
FPAKTITYQAVPSEVPNEEPKVATAYRPPALRNKPITNSKLHEEEPPQNMKPQSGNDKPL
SKTALKNQRKHEAKKAAKQEARSDKSPDLAPTPAPQSTPRNTVSQSISGDPEIDKKIKNL
KKKLKAIEQLKEQAATGKQLEKNQLEKIQKETALLQELEDLELGI
Sequence length 585
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EIF2A-related disorder Likely benign rs199994540 RCV003969112
Hepatocellular carcinoma Uncertain significance rs372635613 RCV005937462
Malignant lymphoma, large B-cell, diffuse Uncertain significance rs372635613 RCV005937463
Malignant tumor of urinary bladder Uncertain significance rs781322944 RCV005932521
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Stimulate 28134810
Adenocarcinoma of Lung Associate 29676829, 31551255, 36226539
Adrenocortical Carcinoma Associate 27631436
Alzheimer Disease Associate 20463975, 26512942, 32665027, 34153352
Angiomyolipoma Associate 22791333
Arthritis Rheumatoid Associate 37862122
Arthritis Rheumatoid Stimulate 40141133
Atherosclerosis Associate 24205197, 28081747
Brain Neoplasms Associate 19188486
Breast Neoplasms Associate 18559534, 23029376, 24204783, 25590579, 27109102, 30655322, 31211507, 32427827, 39187325