Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8388
Gene name Gene Name - the full gene name approved by the HGNC.	Olfactory receptor family 1 subfamily E member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OR1E2
Synonyms (NCBI Gene) Gene synonyms aliases	OR17-135, OR17-136, OR17-93, OR1E4, OR1E7, OST529
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8004088
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8004088
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007606	Process	Sensory perception of chemical stimulus	IEA
GO:0007606	Process	Sensory perception of chemical stimulus	TAS	8004088
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038023	Function	Signaling receptor activity	TAS	8004088
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

P47887

Protein name

Olfactory receptor 1E2 (Olfactory receptor 17-93/17-135/17-136) (OR17-135) (OR17-136) (OR17-93) (Olfactory receptor 1E4)

Protein function

Odorant receptor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13853	7tm_4	31 → 317	Olfactory receptor	Family

Sequence

MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY
LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY
DRYVAICFPMHYTAICFLLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCAD
NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS
KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYS
LRNRDMKGALERVICKRKNPFLL

Sequence length

323

Interactions

View interactions

	KEGG		Reactome
	Olfactory transduction		Olfactory Signaling Pathway

OR1E2 (olfactory receptor family 1 subfamily E member 2)