Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	83879
Gene name	Cell division cycle associated 7
Gene symbol	CDCA7
Synonyms (NCBI Gene)	ICF3JPO1
Chromosome	2
Chromosome location	2q31.1
Summary	This gene was identified as a c-Myc responsive gene, and behaves as a direct c-Myc target gene. Overexpression of this gene is found to enhance the transformation of lymphoblastoid cells, and it complements a transformation-defective Myc Box II mutant, su

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs370384522	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs772929976	G>A,T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs876657409	G>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs879253738	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005056	hsa-let-7b-5p	Microarray	17699775
MIRT002583	hsa-miR-124-3p	Microarray	15685193
MIRT016410	hsa-miR-193b-3p	Microarray	20304954
MIRT002583	hsa-miR-124-3p	Microarray	15685193
MIRT002583	hsa-miR-124-3p	Microarray	18668037
MIRT023434	hsa-miR-30b-5p	Sequencing	20371350
MIRT030505	hsa-miR-24-3p	Microarray	19748357
MIRT524531	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT524530	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT524529	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT086180	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT086189	hsa-miR-1254	PAR-CLIP	20371350
MIRT086190	hsa-miR-3116	PAR-CLIP	20371350
MIRT086186	hsa-miR-661	PAR-CLIP	20371350
MIRT086181	hsa-miR-299-5p	PAR-CLIP	20371350
MIRT086188	hsa-miR-1271-3p	PAR-CLIP	20371350
MIRT086187	hsa-miR-550a-3-5p	PAR-CLIP	20371350
MIRT086185	hsa-miR-550a-5p	PAR-CLIP	20371350
MIRT086182	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT086191	hsa-miR-550b-2-5p	PAR-CLIP	20371350
MIRT524531	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT524530	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT524529	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT086180	hsa-miR-29b-1-5p	PAR-CLIP	23446348
MIRT086192	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT086189	hsa-miR-1254	PAR-CLIP	23446348
MIRT086190	hsa-miR-3116	PAR-CLIP	23446348
MIRT086186	hsa-miR-661	PAR-CLIP	23446348
MIRT086181	hsa-miR-299-5p	PAR-CLIP	23446348
MIRT086188	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT086187	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT086185	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT086182	hsa-miR-340-5p	PAR-CLIP	23446348
MIRT086191	hsa-miR-550b-2-5p	PAR-CLIP	23446348
MIRT497737	hsa-miR-4668-3p	PAR-CLIP	22291592
MIRT497736	hsa-miR-4804-3p	PAR-CLIP	22291592
MIRT497735	hsa-miR-4720-3p	PAR-CLIP	22291592
MIRT524531	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT524530	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT524529	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT086180	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT086189	hsa-miR-1254	PAR-CLIP	20371350
MIRT086190	hsa-miR-3116	PAR-CLIP	20371350
MIRT086186	hsa-miR-661	PAR-CLIP	20371350
MIRT086181	hsa-miR-299-5p	PAR-CLIP	20371350
MIRT086188	hsa-miR-1271-3p	PAR-CLIP	20371350
MIRT086187	hsa-miR-550a-3-5p	PAR-CLIP	20371350
MIRT086185	hsa-miR-550a-5p	PAR-CLIP	20371350
MIRT086182	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT086191	hsa-miR-550b-2-5p	PAR-CLIP	20371350
MIRT524531	hsa-miR-3606-3p	PAR-CLIP	23446348
MIRT524530	hsa-miR-513a-3p	PAR-CLIP	23446348
MIRT524529	hsa-miR-513c-3p	PAR-CLIP	23446348
MIRT086180	hsa-miR-29b-1-5p	PAR-CLIP	23446348
MIRT086192	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT086189	hsa-miR-1254	PAR-CLIP	23446348
MIRT086190	hsa-miR-3116	PAR-CLIP	23446348
MIRT086186	hsa-miR-661	PAR-CLIP	23446348
MIRT086181	hsa-miR-299-5p	PAR-CLIP	23446348
MIRT086188	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT086187	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT086185	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT086182	hsa-miR-340-5p	PAR-CLIP	23446348
MIRT086191	hsa-miR-550b-2-5p	PAR-CLIP	23446348
MIRT497737	hsa-miR-4668-3p	PAR-CLIP	22291592
MIRT497736	hsa-miR-4804-3p	PAR-CLIP	22291592
MIRT497735	hsa-miR-4720-3p	PAR-CLIP	22291592
MIRT879005	hsa-miR-124	CLIP-seq
MIRT879006	hsa-miR-1270	CLIP-seq
MIRT879007	hsa-miR-1273f	CLIP-seq
MIRT879008	hsa-miR-143	CLIP-seq
MIRT879009	hsa-miR-155	CLIP-seq
MIRT879010	hsa-miR-185	CLIP-seq
MIRT879011	hsa-miR-200b	CLIP-seq
MIRT879012	hsa-miR-200c	CLIP-seq
MIRT879013	hsa-miR-208a	CLIP-seq
MIRT879014	hsa-miR-208b	CLIP-seq
MIRT879015	hsa-miR-2113	CLIP-seq
MIRT879016	hsa-miR-2276	CLIP-seq
MIRT879017	hsa-miR-3121-3p	CLIP-seq
MIRT879018	hsa-miR-3163	CLIP-seq
MIRT879019	hsa-miR-3200-3p	CLIP-seq
MIRT879020	hsa-miR-320e	CLIP-seq
MIRT879021	hsa-miR-340	CLIP-seq
MIRT879022	hsa-miR-3658	CLIP-seq
MIRT879023	hsa-miR-3689a-3p	CLIP-seq
MIRT879024	hsa-miR-3689c	CLIP-seq
MIRT879025	hsa-miR-3692	CLIP-seq
MIRT879026	hsa-miR-374c	CLIP-seq
MIRT879027	hsa-miR-3913-3p	CLIP-seq
MIRT879028	hsa-miR-3978	CLIP-seq
MIRT879029	hsa-miR-4289	CLIP-seq
MIRT879030	hsa-miR-429	CLIP-seq
MIRT879031	hsa-miR-4300	CLIP-seq
MIRT879032	hsa-miR-4306	CLIP-seq
MIRT879033	hsa-miR-4425	CLIP-seq
MIRT879034	hsa-miR-4432	CLIP-seq
MIRT879035	hsa-miR-4496	CLIP-seq
MIRT879036	hsa-miR-4525	CLIP-seq
MIRT879037	hsa-miR-4531	CLIP-seq
MIRT879038	hsa-miR-4644	CLIP-seq
MIRT879039	hsa-miR-4677-3p	CLIP-seq
MIRT879040	hsa-miR-4708-5p	CLIP-seq
MIRT879041	hsa-miR-4716-3p	CLIP-seq
MIRT879042	hsa-miR-4717-3p	CLIP-seq
MIRT879043	hsa-miR-4735-5p	CLIP-seq
MIRT879044	hsa-miR-4770	CLIP-seq
MIRT879045	hsa-miR-4772-3p	CLIP-seq
MIRT879046	hsa-miR-4775	CLIP-seq
MIRT879047	hsa-miR-4779	CLIP-seq
MIRT879048	hsa-miR-4795-3p	CLIP-seq
MIRT879049	hsa-miR-499-5p	CLIP-seq
MIRT879050	hsa-miR-506	CLIP-seq
MIRT879051	hsa-miR-515-5p	CLIP-seq
MIRT879052	hsa-miR-518a-5p	CLIP-seq
MIRT879053	hsa-miR-527	CLIP-seq
MIRT879054	hsa-miR-548an	CLIP-seq
MIRT879055	hsa-miR-548n	CLIP-seq
MIRT879056	hsa-miR-548t	CLIP-seq
MIRT879057	hsa-miR-583	CLIP-seq
MIRT879058	hsa-miR-590-3p	CLIP-seq
MIRT879059	hsa-miR-620	CLIP-seq
MIRT879060	hsa-miR-625	CLIP-seq
MIRT879061	hsa-miR-642b	CLIP-seq
MIRT879062	hsa-miR-655	CLIP-seq
MIRT879063	hsa-miR-920	CLIP-seq
MIRT2197280	hsa-miR-151-3p	CLIP-seq
MIRT2197281	hsa-miR-183	CLIP-seq
MIRT2197282	hsa-miR-3120-3p	CLIP-seq
MIRT2197283	hsa-miR-3908	CLIP-seq
MIRT2197284	hsa-miR-4463	CLIP-seq
MIRT2197285	hsa-miR-4499	CLIP-seq
MIRT2197286	hsa-miR-4520a-3p	CLIP-seq
MIRT2197287	hsa-miR-4520b-3p	CLIP-seq
MIRT2197288	hsa-miR-4756-3p	CLIP-seq
MIRT2197289	hsa-miR-495	CLIP-seq
MIRT879055	hsa-miR-548n	CLIP-seq
MIRT879056	hsa-miR-548t	CLIP-seq
MIRT2197290	hsa-miR-4468	CLIP-seq
MIRT2436215	hsa-miR-1236	CLIP-seq
MIRT2436216	hsa-miR-4528	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
E2F1	Activation	16580749
MYC	Unknown	16580749

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11598121
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0042127	Process	Regulation of cell population proliferation	IDA	11598121
GO:0044729	Function	Hemi-methylated DNA-binding	IDA	39178260

MIM	HGNC	e!Ensembl
609937	14628	ENSG00000144354

Q9BWT1

Protein name

Cell division cycle-associated protein 7 (Protein JPO1)

Protein function

Participates in MYC-mediated cell transformation and apoptosis; induces anchorage-independent growth and clonogenicity in lymphoblastoid cells. Insufficient to induce tumorigenicity when overexpressed but contributes to MYC-mediated tumorigenesi

PDB

8TLK , 8YV8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10497	zf-4CXXC_R1	262 → 360	Zinc-finger domain of monoamine-oxidase A repressor R1	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous with higher level in thymus and small intestine. Overexpressed in a large number of tumors, in blood from patients with acute myelogenous leukemia (AML) and in chronic myelogenous leukemia (CML) blast crisis. {ECO:0000269|Pu

Sequence

MDARRVPQKDLRVKKNLKKFRYVKLISMETSSSSDDSCDSFASDNFANTRLQSVREGCRT
RSQCRHSGPLRVAMKFPARSTRGATNKKAESRQPSENSVTDSNSDSEDESGMNFLEKRAL
NIKQNKAMLAKLMSELESFPGSFRGRHPLPGSDSQSRRPRRRTFPGVASRRNPERRARPL
TRSRSRILGSLDALPMEEEEEEDKYMLVRKRKTVDGYMNEDDLPRSRRSRSSVTLPHIIR
PVEEITEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPC
LRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYL
KSLKQEFEMQA

Sequence length

371

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CDCA7-related disorder	Likely benign; Benign	rs371105923, rs2288992, rs763557777, rs773129433, rs145586650, rs146148251, rs138353896	RCV003933681 RCV003923740 RCV003923560 RCV003909562 RCV004758114 RCV003967958 RCV003928620
Immunodeficiency-centromeric instability-facial anomalies syndrome 3	Benign; Likely benign; no classifications from unflagged records; Conflicting classifications of pathogenicity; Uncertain significance	rs113611019, rs4972555, rs2288993, rs754138992, rs879253738, rs876657409, rs772929976, rs370384522, rs2468428983, rs1333528726, rs116079323, rs146148251, rs770948684	RCV005232375 RCV001554862 RCV001554382 RCV005232899 RCV000210913 RCV000210916 RCV000210909 RCV000210914 RCV003142430 RCV003756652 RCV003754900 RCV003754890 RCV002480780

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	32221746
Breast Neoplasms	Associate	24743323
Burkitt Lymphoma	Stimulate	29880607
Carcinogenesis	Associate	37510310
Carcinoma Hepatocellular	Associate	36860864
Colorectal Neoplasms	Stimulate	32319649
Esophageal Squamous Cell Carcinoma	Associate	36056599
Glioblastoma	Associate	40114265
Glioma	Associate	37510310, 38181024
Head and Neck Neoplasms	Associate	33160365
Hypertension	Associate	24165912
Immunodeficiency syndrome variable	Associate	26216346, 30307408, 33082427, 39178265
Immunologic Deficiency Syndromes	Associate	30307408, 39178260
Inflammation	Associate	28355295
Kidney Neoplasms	Associate	33626918
Lupus Erythematosus Systemic	Associate	40185033
Lymphatic Metastasis	Associate	32319649
Neoplasm Metastasis	Associate	32319649
Neoplasm Metastasis	Stimulate	36056599
Neoplasms	Associate	29880607, 32319649, 32716971, 34082692, 34551671, 36056599, 36860864, 37510310, 37686244
Orofaciodigital syndrome 11	Associate	39178260
Ovarian Neoplasms	Associate	34551671
Retinoblastoma	Associate	26662407
Squamous Cell Carcinoma of Head and Neck	Associate	32716971
Stomach Neoplasms	Associate	34082692
Tuberculosis Pulmonary	Associate	28355295

CDCA7 (cell division cycle associated 7)