Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83876
Gene name Gene Name - the full gene name approved by the HGNC.
Maestro
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MRO
Synonyms (NCBI Gene) Gene synonyms aliases
B29, C18orf3
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. Multiple transcript variants encoding different isoforms have been found for th
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT716469 hsa-miR-7109-3p HITS-CLIP 19536157
MIRT716468 hsa-miR-548ag HITS-CLIP 19536157
MIRT716467 hsa-miR-548ai HITS-CLIP 19536157
MIRT716466 hsa-miR-548ba HITS-CLIP 19536157
MIRT716465 hsa-miR-570-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005730 Component Nucleolus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608080 24121 ENSG00000134042
Protein
UniProt ID Q9BYG7
Protein name Protein maestro (Male-specific transcription in the developing reproductive organs) (Protein B29)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11401430}.
Sequence
MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSKVSWKLRFQKREPLKNVFFILAERARDP
SAKKRHMAMRNLGTMAYEAPDKVRKYKKIVLDLLVYGLYDPVNLEVIHESMKTLTVVLGK
IQGKGLGSFFIDITLQTRTLLDDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRD
SLLIHLQDRNPQVAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQ
FFYANKIL
Sequence length 248
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS