Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	83862
Gene name	Transmembrane protein 120A
Gene symbol	TMEM120A
Synonyms (NCBI Gene)	NET29TACANTMPIT
Chromosome	7
Chromosome location	7q11.23

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019165	hsa-miR-335-5p	Microarray	18185580
MIRT1430149	hsa-miR-1254	CLIP-seq
MIRT1430150	hsa-miR-1281	CLIP-seq
MIRT1430151	hsa-miR-147	CLIP-seq
MIRT1430152	hsa-miR-3116	CLIP-seq
MIRT1430153	hsa-miR-3152-5p	CLIP-seq
MIRT1430154	hsa-miR-3184	CLIP-seq
MIRT1430155	hsa-miR-3192	CLIP-seq
MIRT1430156	hsa-miR-3686	CLIP-seq
MIRT1430157	hsa-miR-423-5p	CLIP-seq
MIRT1430158	hsa-miR-4314	CLIP-seq
MIRT1430159	hsa-miR-4646-5p	CLIP-seq
MIRT1430160	hsa-miR-4652-3p	CLIP-seq
MIRT1430161	hsa-miR-4742-3p	CLIP-seq
MIRT1430162	hsa-miR-4774-3p	CLIP-seq
MIRT1430163	hsa-miR-4774-5p	CLIP-seq
MIRT1430164	hsa-miR-566	CLIP-seq
MIRT1430165	hsa-miR-661	CLIP-seq
MIRT2128831	hsa-miR-361-3p	CLIP-seq
MIRT2128832	hsa-miR-4290	CLIP-seq
MIRT2128833	hsa-miR-4687-5p	CLIP-seq
MIRT2128834	hsa-miR-4768-3p	CLIP-seq
MIRT2128835	hsa-miR-665	CLIP-seq
MIRT2128831	hsa-miR-361-3p	CLIP-seq
MIRT2128834	hsa-miR-4768-3p	CLIP-seq
MIRT2128835	hsa-miR-665	CLIP-seq
MIRT2128831	hsa-miR-361-3p	CLIP-seq
MIRT2128834	hsa-miR-4768-3p	CLIP-seq
MIRT2128835	hsa-miR-665	CLIP-seq
MIRT2644016	hsa-miR-1207-5p	CLIP-seq
MIRT1430150	hsa-miR-1281	CLIP-seq
MIRT2644017	hsa-miR-1285	CLIP-seq
MIRT2644018	hsa-miR-188-3p	CLIP-seq
MIRT2644019	hsa-miR-1909	CLIP-seq
MIRT1430154	hsa-miR-3184	CLIP-seq
MIRT2644020	hsa-miR-3187-5p	CLIP-seq
MIRT2644021	hsa-miR-326	CLIP-seq
MIRT2644022	hsa-miR-330-5p	CLIP-seq
MIRT2644023	hsa-miR-378g	CLIP-seq
MIRT1430157	hsa-miR-423-5p	CLIP-seq
MIRT2644024	hsa-miR-4271	CLIP-seq
MIRT2644025	hsa-miR-4436a	CLIP-seq
MIRT2644026	hsa-miR-4486	CLIP-seq
MIRT2644027	hsa-miR-4493	CLIP-seq
MIRT2644028	hsa-miR-4700-3p	CLIP-seq
MIRT2644029	hsa-miR-4725-3p	CLIP-seq
MIRT2644030	hsa-miR-4747-5p	CLIP-seq
MIRT2644031	hsa-miR-4749-3p	CLIP-seq
MIRT2644032	hsa-miR-4763-3p	CLIP-seq
MIRT2644033	hsa-miR-532-3p	CLIP-seq
MIRT1430164	hsa-miR-566	CLIP-seq
MIRT2644034	hsa-miR-612	CLIP-seq
MIRT2644016	hsa-miR-1207-5p	CLIP-seq
MIRT1430150	hsa-miR-1281	CLIP-seq
MIRT2644017	hsa-miR-1285	CLIP-seq
MIRT2644018	hsa-miR-188-3p	CLIP-seq
MIRT2644019	hsa-miR-1909	CLIP-seq
MIRT1430154	hsa-miR-3184	CLIP-seq
MIRT2644020	hsa-miR-3187-5p	CLIP-seq
MIRT2644021	hsa-miR-326	CLIP-seq
MIRT2644022	hsa-miR-330-5p	CLIP-seq
MIRT2644023	hsa-miR-378g	CLIP-seq
MIRT1430157	hsa-miR-423-5p	CLIP-seq
MIRT2644024	hsa-miR-4271	CLIP-seq
MIRT2644025	hsa-miR-4436a	CLIP-seq
MIRT2644026	hsa-miR-4486	CLIP-seq
MIRT2644027	hsa-miR-4493	CLIP-seq
MIRT2644028	hsa-miR-4700-3p	CLIP-seq
MIRT2644029	hsa-miR-4725-3p	CLIP-seq
MIRT2644030	hsa-miR-4747-5p	CLIP-seq
MIRT2644031	hsa-miR-4749-3p	CLIP-seq
MIRT2644032	hsa-miR-4763-3p	CLIP-seq
MIRT2644033	hsa-miR-532-3p	CLIP-seq
MIRT1430164	hsa-miR-566	CLIP-seq
MIRT2644034	hsa-miR-612	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005216	Function	Monoatomic ion channel activity	IDA	34409941, 34465718
GO:0005216	Function	Monoatomic ion channel activity	IMP	34374645
GO:0005216	Function	Monoatomic ion channel activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 35013224, 36420836
GO:0005634	Component	Nucleus	IEA
GO:0005637	Component	Nuclear inner membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	35013224
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IDA	35013224
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045444	Process	Fat cell differentiation	IBA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	IMP	26024229
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	ISS
GO:0051260	Process	Protein homooligomerization	IDA	26024229
GO:0051260	Process	Protein homooligomerization	IEA
GO:0051291	Process	Protein heterooligomerization	IDA	26024229
GO:0051291	Process	Protein heterooligomerization	IEA
GO:0120225	Function	Coenzyme A binding	IDA	34374645
GO:0120225	Function	Coenzyme A binding	IEA
GO:0140374	Process	Antiviral innate immune response	IEA
GO:0140374	Process	Antiviral innate immune response	IMP	35013224

MIM	HGNC	e!Ensembl
616550	21697	ENSG00000189077

Q9BXJ8

Protein name

Transmembrane protein 120A (Protein TACAN) (Transmembrane protein induced by tumor necrosis factor alpha)

Protein function

Multifunctional protein involved in mechanosensation, and plays an essential role in lipid metabolism and adipocyte differentiation (PubMed:26024229, PubMed:36420836). May function as a potential ion channel involved in sensing mechanical stimul

PDB

7CXR , 7F3T , 7F3U , 7F6V , 7N7P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07851	TMPIT	13 → 336	TMPIT-like protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in nociceptors. {ECO:0000269|PubMed:32084332}.

Sequence

MQPPPPGPLGDCLRDWEDLQQDFQNIQETHRLYRLKLEELTKLQNNCTSSITRQKKRLQE
LALALKKCKPSLPAEAEGAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL
LSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES
ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY
QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLAQDP
QCKEWQVLMCGFPFLLLFLGNFFTTLRVVHHKFHSQRHGSKKD

Sequence length

343

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANTLEY-BIXLER SYNDROME WITH DISORDERED STEROIDOGENESIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TMEM120A (transmembrane protein 120A)