ANGPTL6 (angiopoietin like 6)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 83854
Gene name Angiopoietin like 6
Gene symbol ANGPTL6
Synonyms (NCBI Gene)
AGFARP5
Chromosome 19
Chromosome location 19p13.2
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT2171288 hsa-miR-128 CLIP-seq
MIRT2171289 hsa-miR-1915 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0005102 Function Signaling receptor binding IBA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0007596 Process Blood coagulation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609336 23140 ENSG00000130812
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NI99
Protein name Angiopoietin-related protein 6 (Angiopoietin-like protein 6) (Angiopoietin-related growth factor) (Angiopoietin-related protein 5)
Protein function May play a role in the wound healing process. May promote epidermal proliferation, remodeling and regeneration. May promote the chemotactic activity of endothelial cells and induce neovascularization. May counteract high-fat diet-induced obesity
PDB 6Y43
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00147 Fibrinogen_C 256 → 468 Fibrinogen beta and gamma chains, C-terminal globular domain Domain
Sequence 
MGKPWLRALQLLLLLGASWARAGAPRCTYTFVLPPQKFTGAVCWSGPASTRATPEAANAS
ELAALRMRVGRHEELLRELQRLAAADGAVAGEVRALRKESRGLSARLGQLRAQLQHEAGP
GAGPGADLGAEPAAALALLGERVLNASAEAQRAAARFHQLDVKFRELAQLVTQQSSLIAR
LERLCPGGAGGQQQVLPPPPLVPVVPVRLVGSTSDTSRMLDPAPEPQRDQTQRQQEPMAS
PMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQ
RRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAH
YDGFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWY
HACAHSNLNGVWHHGGHYRSRYQDGVYWAEFRGGAYSLRKAAMLIRPLKL
Sequence length 470
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
ANGPTL6-related disorder Uncertain significance; Likely benign rs1480689695, rs576667683 RCV003419015
RCV003937318
Show/Hide Text Mining Associations (9)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 34412629, 36421714
Cerebrovascular Disorders Associate 29304371
Hypercholesterolemia Associate 36601873
Hypertension Associate 29304371
Intracranial Aneurysm Associate 29304371, 33106390
Metabolic Diseases Associate 30968619
Metabolic Syndrome Associate 30968619
Osteogenesis imperfecta type 1A Associate 29304371, 33106390
Stomach Neoplasms Inhibit 32410376