ANGPTL6 (angiopoietin like 6)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83854
Gene name Gene Name - the full gene name approved by the HGNC.
Angiopoietin like 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ANGPTL6
Synonyms (NCBI Gene) Gene synonyms aliases
AGF, ARP5
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT2171288 hsa-miR-128 CLIP-seq
MIRT2171289 hsa-miR-1915 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0005102 Function Signaling receptor binding IBA 21873635
GO:0005615 Component Extracellular space IBA 21873635
GO:0030141 Component Secretory granule IEA
GO:0030154 Process Cell differentiation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609336 23140 ENSG00000130812
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8NI99
Protein name Angiopoietin-related protein 6 (Angiopoietin-like protein 6) (Angiopoietin-related growth factor) (Angiopoietin-related protein 5)
Protein function May play a role in the wound healing process. May promote epidermal proliferation, remodeling and regeneration. May promote the chemotactic activity of endothelial cells and induce neovascularization. May counteract high-fat diet-induced obesity
PDB 6Y43
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00147 Fibrinogen_C 256 → 468 Fibrinogen beta and gamma chains, C-terminal globular domain Domain
Sequence 
MGKPWLRALQLLLLLGASWARAGAPRCTYTFVLPPQKFTGAVCWSGPASTRATPEAANAS
ELAALRMRVGRHEELLRELQRLAAADGAVAGEVRALRKESRGLSARLGQLRAQLQHEAGP
GAGPGADLGAEPAAALALLGERVLNASAEAQRAAARFHQLDVKFRELAQLVTQQSSLIAR
LERLCPGGAGGQQQVLPPPPLVPVVPVRLVGSTSDTSRMLDPAPEPQRDQTQRQQEPMAS
PMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQ
RRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAH
YDGFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWY
HACAHSNLNGVWHHGGHYRSRYQDGVYWAEFRGGAYSLRKAAMLIRPLKL
Sequence length 470
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Aortic dissection Dissection of aorta rs1553507345
Hypertension Hypertensive disease rs13306026
Intracranial aneurysm ANEURYSM, INTRACRANIAL BERRY, 1 (disorder) rs1594095223 29304371
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Atherosclerosis Atherosclerosis ClinVar
Acrania intracranial berry aneurysm GenCC
Show/Hide Text Mining Associations (9)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 34412629, 36421714
Cerebrovascular Disorders Associate 29304371
Hypercholesterolemia Associate 36601873
Hypertension Associate 29304371
Intracranial Aneurysm Associate 29304371, 33106390
Metabolic Diseases Associate 30968619
Metabolic Syndrome Associate 30968619
Osteogenesis imperfecta type 1A Associate 29304371, 33106390
Stomach Neoplasms Inhibit 32410376