Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83700
Gene name Gene Name - the full gene name approved by the HGNC.
Junctional adhesion molecule 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
JAM3
Synonyms (NCBI Gene) Gene synonyms aliases
JAM-2, JAM-3, JAM-C, JAMC
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q25
Summary Summary of gene provided in NCBI Entrez Gene.
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs397514678 T>C,G Pathogenic Missense variant, initiator codon variant
rs397515438 G>A Pathogenic Missense variant, coding sequence variant
rs397515439 G>A Pathogenic Missense variant, coding sequence variant, intron variant
rs761700427 G>T Pathogenic Splice donor variant
rs774867496 A>C,G,T Pathogenic Initiator codon variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1076343 hsa-miR-320a CLIP-seq
MIRT1076344 hsa-miR-320b CLIP-seq
MIRT1076345 hsa-miR-320c CLIP-seq
MIRT1076346 hsa-miR-320d CLIP-seq
MIRT1076347 hsa-miR-320e CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IDA 20592283
GO:0001525 Process Angiogenesis IEA
GO:0001780 Process Neutrophil homeostasis IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002318 Process Myeloid progenitor cell differentiation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606871 15532 ENSG00000166086
Protein
UniProt ID Q9BX67
Protein name Junctional adhesion molecule C (JAM-C) (JAM-2) (Junctional adhesion molecule 3) (JAM-3) [Cleaved into: Soluble form of JAM-C (sJAM-C)]
Protein function Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM2 to regulate different cellular processes (PubMed:11590146, PubMed:11823489). Plays a role in homing and mobilization of hematopoietic ste
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 36 136 Immunoglobulin V-set domain Domain
PF13927 Ig_3 138 223 Domain
Tissue specificity TISSUE SPECIFICITY: Detected on round and elongated spermatids (at protein level) (PubMed:15372036). Highest expression in placenta, brain and kidney. Significant expression is detected on platelets. Expressed in intestinal mucosa cells. Expressed in the
Sequence
MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQT
SDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVAR
NDRKEIDEIVIELTVQ
VKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPL
PTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASN
DAGSARCEEQEMEVYDL
NIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEG
DFRHKSSFVI
Sequence length 310
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules
Tight junction
Leukocyte transendothelial migration
Epithelial cell signaling in Helicobacter pylori infection
  Cell surface interactions at the vascular wall
Integrin cell surface interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Porencephaly-Microcephaly-Bilateral Congenital Cataract Syndrome porencephaly-microcephaly-bilateral congenital cataract syndrome rs761700427, rs397515438, rs397515439, rs397514678, rs774867496, rs1942959311 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 33300604
Aicardi Goutieres syndrome Associate 21109224
Arthritis Rheumatoid Associate 18821692
Atherosclerosis Associate 27573188
Atrial Fibrillation Associate 36653368
Attention Deficit and Disruptive Behavior Disorders Associate 27164683
Atypical Squamous Cells of the Cervix Associate 39528979
Baraitser Brett Piesowicz syndrome Associate 27164683
Breast Neoplasms Associate 30146936
Calcinosis Associate 23255084