Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83698
Gene name Gene Name - the full gene name approved by the HGNC.
Calneuron 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CALN1
Synonyms (NCBI Gene) Gene synonyms aliases
CABP8
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants.
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019343 hsa-miR-148b-3p Microarray 17612493
MIRT053772 hsa-miR-675-5p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24810858
MIRT723394 hsa-miR-7153-3p HITS-CLIP 19536157
MIRT723393 hsa-miR-3127-3p HITS-CLIP 19536157
MIRT723392 hsa-miR-6756-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 30073165, 32296183
GO:0005886 Component Plasma membrane IEA
GO:0016021 Component Integral component of membrane IEA
GO:0032588 Component Trans-Golgi network membrane IDA 19338761
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607176 13248 ENSG00000183166
Protein
UniProt ID Q9BXU9
Protein name Calcium-binding protein 8 (CaBP8) (Calneuron I) (Calneuron-1)
Protein function Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity. May play a role in the physiology of neurons and is potentially important in memory and learning.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 38 102 EF-hand domain pair Domain
Tissue specificity TISSUE SPECIFICITY: Brain specific. {ECO:0000269|PubMed:11286509}.
Sequence
MRLPEQPGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKGNYLN
RSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQE
LGMAMRSLGYMPSEVELA
IIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKH
ILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFA
MAFIISVMLIAANQILRSGME
Sequence length 261
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
30285260, 26198764, 31374203, 28991256
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Dyslexia Dyslexia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Colorectal Neoplasms Associate 33048115
Neoplasms Associate 36352401
Urinary Bladder Neoplasms Associate 36352401
Uterine Cervical Neoplasms Associate 31271297