Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	83643
Gene name Gene Name - the full gene name approved by the HGNC.	Coiled-coil domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCDC3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10p13

Show/Hide all(30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022206	hsa-miR-124-3p	Microarray	18668037
MIRT868812	hsa-miR-138	CLIP-seq
MIRT868813	hsa-miR-1972	CLIP-seq
MIRT868814	hsa-miR-3179	CLIP-seq
MIRT868815	hsa-miR-3202	CLIP-seq
MIRT868816	hsa-miR-3674	CLIP-seq
MIRT868817	hsa-miR-3978	CLIP-seq
MIRT868818	hsa-miR-4274	CLIP-seq
MIRT868819	hsa-miR-4476	CLIP-seq
MIRT868820	hsa-miR-4688	CLIP-seq
MIRT868821	hsa-miR-4694-5p	CLIP-seq
MIRT868822	hsa-miR-4768-5p	CLIP-seq
MIRT868823	hsa-miR-486-3p	CLIP-seq
MIRT868824	hsa-miR-622	CLIP-seq
MIRT868825	hsa-miR-651	CLIP-seq
MIRT868826	hsa-miR-885-3p	CLIP-seq
MIRT1957807	hsa-miR-1207-3p	CLIP-seq
MIRT1957808	hsa-miR-1236	CLIP-seq
MIRT1957809	hsa-miR-198	CLIP-seq
MIRT1957810	hsa-miR-2278	CLIP-seq
MIRT1957811	hsa-miR-3182	CLIP-seq
MIRT1957812	hsa-miR-3649	CLIP-seq
MIRT1957813	hsa-miR-455-3p	CLIP-seq
MIRT1957814	hsa-miR-520a-5p	CLIP-seq
MIRT1957815	hsa-miR-525-5p	CLIP-seq
MIRT1957816	hsa-miR-711	CLIP-seq
MIRT1957817	hsa-miR-888	CLIP-seq
MIRT2194843	hsa-miR-33a	CLIP-seq
MIRT2194844	hsa-miR-33b	CLIP-seq
MIRT2385638	hsa-miR-34b	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	28827783
GO:0005576	Component	Extracellular region	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0007165	Process	Signal transduction	IDA	28827783
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0010629	Process	Negative regulation of gene expression	IBA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	25193116
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045833	Process	Negative regulation of lipid metabolic process	IDA	28827783
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0051055	Process	Negative regulation of lipid biosynthetic process	IEA

MIM	HGNC	e!Ensembl
620579	23813	ENSG00000151468

Protein

UniProt ID

Q9BQI4

Protein name

Coiled-coil domain-containing protein 3 (Fat/vessel-derived secretory protein) (Favine)

Protein function

Negatively regulates TNF-alpha-induced pro-inflammatory response in endothelial cells (ECs) via inhibition of TNF-alpha-induced NF-kappaB activation in ECs (PubMed:25193116). Positively regulates lipid accumulation in adipose cells (By similarit

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in umbilical vein endothelial cells (HUVEC), and at lower levels in aortic smooth muscle cells (HASMC). {ECO:0000269|PubMed:20043878}.

Sequence

MLRQLLLAALCLAGPPAPARACQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYN
HLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSY
FFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQE
DSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLEL
ANQKLSEKLAAGALPHINARGPVRPPYLRG

Sequence length

270

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Lip and Oral Cavity Carcinoma	lip and oral cavity carcinoma	N/A	N/A	ClinVar
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	36647876
Diabetic Nephropathies	Inhibit	33568476
Uterine Cervical Neoplasms	Associate	31081073

CCDC3 (coiled-coil domain containing 3)