CCDC3 (coiled-coil domain containing 3)

Gene

• Entrez ID: 83643
• Gene name: Coiled-coil domain containing 3
• Gene symbol: CCDC3
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10p13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022206	hsa-miR-124-3p	Microarray	18668037
MIRT868812	hsa-miR-138	CLIP-seq
MIRT868813	hsa-miR-1972	CLIP-seq
MIRT868814	hsa-miR-3179	CLIP-seq
MIRT868815	hsa-miR-3202	CLIP-seq
MIRT868816	hsa-miR-3674	CLIP-seq
MIRT868817	hsa-miR-3978	CLIP-seq
MIRT868818	hsa-miR-4274	CLIP-seq
MIRT868819	hsa-miR-4476	CLIP-seq
MIRT868820	hsa-miR-4688	CLIP-seq
MIRT868821	hsa-miR-4694-5p	CLIP-seq
MIRT868822	hsa-miR-4768-5p	CLIP-seq
MIRT868823	hsa-miR-486-3p	CLIP-seq
MIRT868824	hsa-miR-622	CLIP-seq
MIRT868825	hsa-miR-651	CLIP-seq
MIRT868826	hsa-miR-885-3p	CLIP-seq
MIRT1957807	hsa-miR-1207-3p	CLIP-seq
MIRT1957808	hsa-miR-1236	CLIP-seq
MIRT1957809	hsa-miR-198	CLIP-seq
MIRT1957810	hsa-miR-2278	CLIP-seq
MIRT1957811	hsa-miR-3182	CLIP-seq
MIRT1957812	hsa-miR-3649	CLIP-seq
MIRT1957813	hsa-miR-455-3p	CLIP-seq
MIRT1957814	hsa-miR-520a-5p	CLIP-seq
MIRT1957815	hsa-miR-525-5p	CLIP-seq
MIRT1957816	hsa-miR-711	CLIP-seq
MIRT1957817	hsa-miR-888	CLIP-seq
MIRT2194843	hsa-miR-33a	CLIP-seq
MIRT2194844	hsa-miR-33b	CLIP-seq
MIRT2385638	hsa-miR-34b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	28827783
GO:0005576	Component	Extracellular region	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0007165	Process	Signal transduction	IDA	28827783
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0010629	Process	Negative regulation of gene expression	IBA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	25193116
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045833	Process	Negative regulation of lipid metabolic process	IDA	28827783
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0051055	Process	Negative regulation of lipid biosynthetic process	IEA

Other IDs

• MIM: 620579
• HGNC: 23813
• e!Ensembl: ENSG00000151468

Protein

• UniProt ID: Q9BQI4
• Protein name: Coiled-coil domain-containing protein 3 (Fat/vessel-derived secretory protein) (Favine)
• Protein function: Negatively regulates TNF-alpha-induced pro-inflammatory response in endothelial cells (ECs) via inhibition of TNF-alpha-induced NF-kappaB activation in ECs (PubMed:25193116). Positively regulates lipid accumulation in adipose cells (By similarit
• Tissue specificity: TISSUE SPECIFICITY: Expressed in umbilical vein endothelial cells (HUVEC), and at lower levels in aortic smooth muscle cells (HASMC). {ECO:0000269|PubMed:20043878}.
• Sequence:

  MLRQLLLAALCLAGPPAPARACQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYN
  HLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSY
  FFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQE
  DSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLEL
  ANQKLSEKLAAGALPHINARGPVRPPYLRG

• Sequence length: 270

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Lip and oral cavity carcinoma	association not found	rs4748011	RCV000758254

Associations from Text Mining
Disease Name	Relationship Type	References
Breast Neoplasms	Associate	36647876
Diabetic Nephropathies	Inhibit	33568476
Uterine Cervical Neoplasms	Associate	31081073