Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83636
Gene name Gene Name - the full gene name approved by the HGNC.
Chromosome 19 open reading frame 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
C19orf12
Synonyms (NCBI Gene) Gene synonyms aliases
MPAN, NBIA3, NBIA4, SPG43
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a small transmembrane protein. Mutations in this gene are a cause of neurodegeneration with brain iron accumulation-4 (NBIA4), but the specific function of the encoded protein is unknown. Alternatively spliced transcript variants encodin
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs146170087 T>C Uncertain-significance, conflicting-interpretations-of-pathogenicity, not-provided, pathogenic Missense variant, genic downstream transcript variant, 3 prime UTR variant, coding sequence variant
rs200133991 C>T Pathogenic, likely-pathogenic 5 prime UTR variant, genic downstream transcript variant, missense variant, coding sequence variant, intron variant
rs201118405 C>G,T Conflicting-interpretations-of-pathogenicity, benign, benign-likely-benign Synonymous variant, 5 prime UTR variant, genic downstream transcript variant, coding sequence variant, intron variant
rs201987973 G>A Pathogenic Genic downstream transcript variant, coding sequence variant, missense variant
rs376103979 C>G,T Pathogenic, likely-pathogenic 5 prime UTR variant, genic downstream transcript variant, missense variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025866 hsa-miR-7-5p Sequencing 20371350
MIRT042283 hsa-miR-484 CLASH 23622248
MIRT549575 hsa-miR-5197-5p PAR-CLIP 21572407
MIRT549574 hsa-miR-5584-5p PAR-CLIP 21572407
MIRT549573 hsa-miR-6750-5p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 23857908, 26136767
GO:0005739 Component Mitochondrion IEA
GO:0005783 Component Endoplasmic reticulum IDA 23857908, 26136767
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614297 25443 ENSG00000131943
Protein
UniProt ID Q9NSK7
Protein name Protein C19orf12
Family and domains
Sequence
MERLKSHKPATMTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPP
GLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTA
LVMGSEALQQQLLAMLVNYVTKELRAEIQYDD
Sequence length 152
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hereditary spastic paraplegia Hereditary spastic paraplegia 43 rs515726204, rs397514477, rs515726205, rs752450983 N/A
Neurodegeneration With Brain Iron Accumulation neurodegeneration with brain iron accumulation 4 rs387907173, rs1424291552, rs398122409, rs1568326754, rs515726204, rs1599534276, rs1599534394, rs797045423, rs397514477, rs201987973, rs752450983, rs1064797235, rs515726205 N/A
neurodegeneration with brain iron accumulation Neurodegeneration with brain iron accumulation rs515726205, rs752450983, rs398122409, rs515726204, rs397514477 N/A
Neurofibromatosis Neurofibromatosis, type 1 rs398122409 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer (estrogen-receptor negative), Breast cancer N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22433433
Cerebellar Diseases Associate 24361204
Dystonia Associate 35041927
Immune System Diseases Associate 35509008
Iron Deficiencies Associate 24361204
Iron Overload Associate 35182730
Lewy Body Disease Associate 23269600
Muscle Weakness Associate 34022688
Neuroaxonal Dystrophies Associate 34022688
Neurodegenerative Diseases Associate 23269600, 23857908, 33068888, 34022688