CASP3 (caspase 3)

Gene

• Entrez ID: 836
• Gene name: Caspase 3
• Gene symbol: CASP3
• Synonyms (NCBI Gene): CPP32, CPP32B, SCA-1
• Chromosome: 4
• Chromosome location: 4q35.1
• Summary: The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003574	hsa-miR-98-5p	Review	19815577
MIRT005292	hsa-let-7a-5p	Luciferase reporter assay, Western blot	18758960
MIRT005292	hsa-let-7a-5p	Luciferase reporter assay, Western blot	18758960
MIRT006240	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	22058146
MIRT006240	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	22058146
MIRT006240	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	22058146
MIRT006864	hsa-miR-138-5p	Luciferase reporter assay	22921398
MIRT019884	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT021992	hsa-miR-128-3p	Sequencing	20371350
MIRT024157	hsa-miR-221-3p	Sequencing	20371350
MIRT029617	hsa-miR-26b-5p	Microarray	19088304
MIRT048249	hsa-miR-196a-5p	CLASH	23622248
MIRT054129	hsa-miR-421	qRT-PCR, Western blot	25041019
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438730	hsa-miR-363-3p	and NCH441"	24805821
MIRT438730	hsa-miR-363-3p	and NCH441"	24805821
MIRT438729	hsa-miR-582-5p	and NCH441"	24805821
MIRT438729	hsa-miR-582-5p	and NCH441"	24805821
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438878	hsa-miR-885-5p	Luciferase reporter assay	23271051
MIRT438730	hsa-miR-363-3p	and NCH441"	24805821
MIRT438730	hsa-miR-363-3p	and NCH441"	24805821
MIRT438729	hsa-miR-582-5p	and NCH441"	24805821
MIRT438729	hsa-miR-582-5p	and NCH441"	24805821
MIRT487458	hsa-miR-548n	PAR-CLIP	23592263
MIRT164579	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT487457	hsa-miR-562	PAR-CLIP	23592263
MIRT487456	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT487455	hsa-miR-6076	PAR-CLIP	23592263
MIRT487454	hsa-miR-6797-3p	PAR-CLIP	23592263
MIRT164595	hsa-miR-6124	PAR-CLIP	23592263
MIRT487453	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT487452	hsa-miR-4666b	PAR-CLIP	23592263
MIRT487451	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT441002	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT441003	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT728049	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT728050	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT437365	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT006240	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT728048	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT441002	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT441003	hsa-miR-382-5p	HITS-CLIP	24374217
MIRT003574	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26367177
MIRT054129	hsa-miR-421	Luciferase reporter assay	27016414
MIRT054129	hsa-miR-421	Luciferase reporter assay	27016414
MIRT728048	hsa-miR-30e-5p	Luciferase reporter assay	26895377
MIRT728048	hsa-miR-30e-5p	Luciferase reporter assay	26895377
MIRT356254	hsa-let-7b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26296645
MIRT732067	hsa-miR-224-5p	Luciferase reporter assay, Western blot	26307684
MIRT732067	hsa-miR-224-5p	Luciferase reporter assay, Western blot	26307684
MIRT054129	hsa-miR-421	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27016414
MIRT054129	hsa-miR-421	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27016414
MIRT732590	hsa-miR-133a-3p	Immunofluorescence, qRT-PCR, Western blotting	33639970
MIRT734060	hsa-miR-612	qRT-PCR	33564285
MIRT006864	hsa-miR-138-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33856081
MIRT734992	hsa-let-7e-3p	qRT-PCR	33066614
MIRT735171	hsa-miR-7-5p	Microarray, qRT-PCR	33468167
MIRT735254	hsa-miR-30d-3p	Microarray, qRT-PCR	32407273
MIRT006864	hsa-miR-138-5p	Western blotting, qRT-PCR	32388607
MIRT006864	hsa-miR-138-5p	Western blotting, qRT-PCR	32388607
MIRT487458	hsa-miR-548n	PAR-CLIP	23592263
MIRT164579	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT487457	hsa-miR-562	PAR-CLIP	23592263
MIRT487456	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT487455	hsa-miR-6076	PAR-CLIP	23592263
MIRT487454	hsa-miR-6797-3p	PAR-CLIP	23592263
MIRT164595	hsa-miR-6124	PAR-CLIP	23592263
MIRT487453	hsa-miR-5011-3p	PAR-CLIP	23592263
MIRT487452	hsa-miR-4666b	PAR-CLIP	23592263
MIRT487451	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT755542	hsa-miR-181c-5p	Western blotting, qRT-PCR	36676955
MIRT755862	hsa-miR-107	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry, ELISA	38828010
MIRT755862	hsa-miR-107	Immunoprecipitaion (IP)	36816358
MIRT756319	hsa-miR-29b-1-5p	Western blotting, Immunofluorescence	38934067
MIRT756379	hsa-miR-139-5p	Western blotting	37794118
MIRT864029	hsa-miR-1304	CLIP-seq
MIRT864030	hsa-miR-137	CLIP-seq
MIRT864031	hsa-miR-1825	CLIP-seq
MIRT864032	hsa-miR-197	CLIP-seq
MIRT864033	hsa-miR-3152-5p	CLIP-seq
MIRT864034	hsa-miR-4760-3p	CLIP-seq
MIRT864035	hsa-miR-4789-3p	CLIP-seq
MIRT864036	hsa-miR-891b	CLIP-seq
MIRT864037	hsa-miR-103a	CLIP-seq
MIRT755862	hsa-miR-107	CLIP-seq
MIRT864038	hsa-miR-1184	CLIP-seq
MIRT864039	hsa-miR-1205	CLIP-seq
MIRT864040	hsa-miR-1287	CLIP-seq
MIRT864030	hsa-miR-137	CLIP-seq
MIRT864032	hsa-miR-197	CLIP-seq
MIRT864041	hsa-miR-24	CLIP-seq
MIRT864033	hsa-miR-3152-5p	CLIP-seq
MIRT864042	hsa-miR-3158-5p	CLIP-seq
MIRT864043	hsa-miR-3176	CLIP-seq
MIRT864044	hsa-miR-3202	CLIP-seq
MIRT864045	hsa-miR-3616-3p	CLIP-seq
MIRT864046	hsa-miR-3652	CLIP-seq
MIRT864047	hsa-miR-3658	CLIP-seq
MIRT864048	hsa-miR-3662	CLIP-seq
MIRT864049	hsa-miR-376c	CLIP-seq
MIRT864050	hsa-miR-3922-3p	CLIP-seq
MIRT864051	hsa-miR-4430	CLIP-seq
MIRT864052	hsa-miR-4437	CLIP-seq
MIRT864053	hsa-miR-4533	CLIP-seq
MIRT864054	hsa-miR-455-5p	CLIP-seq
MIRT864055	hsa-miR-4662a-3p	CLIP-seq
MIRT864056	hsa-miR-4693-3p	CLIP-seq
MIRT864057	hsa-miR-4698	CLIP-seq
MIRT864058	hsa-miR-4712-3p	CLIP-seq
MIRT864059	hsa-miR-4721	CLIP-seq
MIRT864060	hsa-miR-4757-5p	CLIP-seq
MIRT864061	hsa-miR-4773	CLIP-seq
MIRT864062	hsa-miR-518d-5p	CLIP-seq
MIRT864063	hsa-miR-519b-5p	CLIP-seq
MIRT864064	hsa-miR-519c-5p	CLIP-seq
MIRT864065	hsa-miR-520c-5p	CLIP-seq
MIRT864066	hsa-miR-526a	CLIP-seq
MIRT864067	hsa-miR-548a-5p	CLIP-seq
MIRT864068	hsa-miR-548ab	CLIP-seq
MIRT864069	hsa-miR-548ak	CLIP-seq
MIRT864070	hsa-miR-548b-5p	CLIP-seq
MIRT864071	hsa-miR-548c-5p	CLIP-seq
MIRT864072	hsa-miR-548d-5p	CLIP-seq
MIRT864073	hsa-miR-548h	CLIP-seq
MIRT864074	hsa-miR-548i	CLIP-seq
MIRT864075	hsa-miR-548j	CLIP-seq
MIRT864076	hsa-miR-548k	CLIP-seq
MIRT864077	hsa-miR-548l	CLIP-seq
MIRT864078	hsa-miR-548w	CLIP-seq
MIRT864079	hsa-miR-548y	CLIP-seq
MIRT864080	hsa-miR-559	CLIP-seq
MIRT864081	hsa-miR-603	CLIP-seq
MIRT864082	hsa-miR-654-3p	CLIP-seq
MIRT1546174	hsa-let-7a	CLIP-seq
MIRT1546175	hsa-let-7b	CLIP-seq
MIRT1546176	hsa-let-7c	CLIP-seq
MIRT1546177	hsa-let-7d	CLIP-seq
MIRT1546178	hsa-let-7e	CLIP-seq
MIRT1546179	hsa-let-7f	CLIP-seq
MIRT1546180	hsa-let-7g	CLIP-seq
MIRT1546181	hsa-let-7i	CLIP-seq
MIRT864029	hsa-miR-1304	CLIP-seq
MIRT1546182	hsa-miR-138	CLIP-seq
MIRT1546183	hsa-miR-140-5p	CLIP-seq
MIRT1546184	hsa-miR-202	CLIP-seq
MIRT1546185	hsa-miR-3545-5p	CLIP-seq
MIRT1546186	hsa-miR-376a	CLIP-seq
MIRT1546187	hsa-miR-376b	CLIP-seq
MIRT1546188	hsa-miR-4458	CLIP-seq
MIRT1546189	hsa-miR-4460	CLIP-seq
MIRT1546190	hsa-miR-4500	CLIP-seq
MIRT1546191	hsa-miR-98	CLIP-seq
MIRT1556132	hsa-miR-369-3p	CLIP-seq
MIRT1556133	hsa-miR-374a	CLIP-seq
MIRT1556134	hsa-miR-374b	CLIP-seq
MIRT1556135	hsa-miR-3942-3p	CLIP-seq
MIRT1556136	hsa-miR-410	CLIP-seq
MIRT756379	hsa-miR-139-5p	CLIP-seq
MIRT864047	hsa-miR-3658	CLIP-seq
MIRT864055	hsa-miR-4662a-3p	CLIP-seq
MIRT1956145	hsa-miR-4666-5p	CLIP-seq
MIRT1956146	hsa-miR-4795-3p	CLIP-seq
MIRT1956147	hsa-miR-5095	CLIP-seq
MIRT1956148	hsa-miR-514	CLIP-seq
MIRT1956149	hsa-miR-514b-3p	CLIP-seq
MIRT1956150	hsa-miR-601	CLIP-seq
MIRT864081	hsa-miR-603	CLIP-seq
MIRT1546182	hsa-miR-138	CLIP-seq
MIRT864034	hsa-miR-4760-3p	CLIP-seq
MIRT864037	hsa-miR-103a	CLIP-seq
MIRT755862	hsa-miR-107	CLIP-seq
MIRT2193795	hsa-miR-1229	CLIP-seq
MIRT2193796	hsa-miR-203	CLIP-seq
MIRT2193797	hsa-miR-2277-3p	CLIP-seq
MIRT2193798	hsa-miR-3614-5p	CLIP-seq
MIRT2193799	hsa-miR-3660	CLIP-seq
MIRT2193800	hsa-miR-3672	CLIP-seq
MIRT2193801	hsa-miR-3977	CLIP-seq
MIRT2193802	hsa-miR-4526	CLIP-seq
MIRT2193803	hsa-miR-4642	CLIP-seq
MIRT2193804	hsa-miR-4676-5p	CLIP-seq
MIRT864058	hsa-miR-4712-3p	CLIP-seq
MIRT864034	hsa-miR-4760-3p	CLIP-seq
MIRT2193805	hsa-miR-550b	CLIP-seq
MIRT2193806	hsa-miR-566	CLIP-seq
MIRT2193807	hsa-miR-575	CLIP-seq
MIRT2193808	hsa-miR-652	CLIP-seq
MIRT864082	hsa-miR-654-3p	CLIP-seq
MIRT2193809	hsa-miR-885-3p	CLIP-seq
MIRT2193810	hsa-miR-890	CLIP-seq
MIRT2193811	hsa-miR-942	CLIP-seq
MIRT2385555	hsa-miR-513b	CLIP-seq
MIRT2427045	hsa-miR-23a	CLIP-seq
MIRT2427046	hsa-miR-23b	CLIP-seq
MIRT2427047	hsa-miR-23c	CLIP-seq
MIRT2427048	hsa-miR-323-3p	CLIP-seq
MIRT2427049	hsa-miR-337-3p	CLIP-seq
MIRT2427050	hsa-miR-382	CLIP-seq
MIRT2427051	hsa-miR-4326	CLIP-seq
MIRT2427052	hsa-miR-4709-5p	CLIP-seq
MIRT2427053	hsa-miR-4794	CLIP-seq
MIRT2427054	hsa-miR-619	CLIP-seq
MIRT2446205	hsa-miR-144	CLIP-seq
MIRT2446206	hsa-miR-30a	CLIP-seq
MIRT2446207	hsa-miR-30b	CLIP-seq
MIRT2446208	hsa-miR-30c	CLIP-seq
MIRT2446209	hsa-miR-30d	CLIP-seq
MIRT2446210	hsa-miR-30e	CLIP-seq
MIRT2496952	hsa-miR-1254	CLIP-seq
MIRT2496953	hsa-miR-1256	CLIP-seq
MIRT2496954	hsa-miR-1283	CLIP-seq
MIRT864040	hsa-miR-1287	CLIP-seq
MIRT1546182	hsa-miR-138	CLIP-seq
MIRT2446205	hsa-miR-144	CLIP-seq
MIRT2496955	hsa-miR-153	CLIP-seq
MIRT2496956	hsa-miR-190	CLIP-seq
MIRT2496957	hsa-miR-190b	CLIP-seq
MIRT2496958	hsa-miR-221	CLIP-seq
MIRT2496959	hsa-miR-222	CLIP-seq
MIRT2193797	hsa-miR-2277-3p	CLIP-seq
MIRT864041	hsa-miR-24	CLIP-seq
MIRT2496960	hsa-miR-29a	CLIP-seq
MIRT2496961	hsa-miR-29b	CLIP-seq
MIRT2496962	hsa-miR-29c	CLIP-seq
MIRT2446206	hsa-miR-30a	CLIP-seq
MIRT2446207	hsa-miR-30b	CLIP-seq
MIRT2446208	hsa-miR-30c	CLIP-seq
MIRT2446209	hsa-miR-30d	CLIP-seq
MIRT2446210	hsa-miR-30e	CLIP-seq
MIRT2496963	hsa-miR-3116	CLIP-seq
MIRT2496964	hsa-miR-3145-3p	CLIP-seq
MIRT864033	hsa-miR-3152-5p	CLIP-seq
MIRT2496965	hsa-miR-3163	CLIP-seq
MIRT864043	hsa-miR-3176	CLIP-seq
MIRT2496966	hsa-miR-320a	CLIP-seq
MIRT2496967	hsa-miR-320b	CLIP-seq
MIRT2496968	hsa-miR-320c	CLIP-seq
MIRT2496969	hsa-miR-320d	CLIP-seq
MIRT2496970	hsa-miR-342-3p	CLIP-seq
MIRT2496971	hsa-miR-3529	CLIP-seq
MIRT2496972	hsa-miR-3607-3p	CLIP-seq
MIRT2496973	hsa-miR-3614-3p	CLIP-seq
MIRT864045	hsa-miR-3616-3p	CLIP-seq
MIRT864046	hsa-miR-3652	CLIP-seq
MIRT2193800	hsa-miR-3672	CLIP-seq
MIRT2496974	hsa-miR-370	CLIP-seq
MIRT2496975	hsa-miR-379	CLIP-seq
MIRT864050	hsa-miR-3922-3p	CLIP-seq
MIRT2496976	hsa-miR-4254	CLIP-seq
MIRT2496977	hsa-miR-4317	CLIP-seq
MIRT2496978	hsa-miR-4429	CLIP-seq
MIRT864051	hsa-miR-4430	CLIP-seq
MIRT864052	hsa-miR-4437	CLIP-seq
MIRT2496979	hsa-miR-4451	CLIP-seq
MIRT2496980	hsa-miR-4532	CLIP-seq
MIRT864054	hsa-miR-455-5p	CLIP-seq
MIRT2496981	hsa-miR-4639-5p	CLIP-seq
MIRT2496982	hsa-miR-4649-3p	CLIP-seq
MIRT2496983	hsa-miR-4650-3p	CLIP-seq
MIRT2496984	hsa-miR-4656	CLIP-seq
MIRT2496985	hsa-miR-4663	CLIP-seq
MIRT2193804	hsa-miR-4676-5p	CLIP-seq
MIRT2496986	hsa-miR-4685-5p	CLIP-seq
MIRT2496987	hsa-miR-4688	CLIP-seq
MIRT864059	hsa-miR-4721	CLIP-seq
MIRT2496988	hsa-miR-4728-3p	CLIP-seq
MIRT864060	hsa-miR-4757-5p	CLIP-seq
MIRT2496989	hsa-miR-4763-5p	CLIP-seq
MIRT2496990	hsa-miR-4768-5p	CLIP-seq
MIRT1956146	hsa-miR-4795-3p	CLIP-seq
MIRT2496991	hsa-miR-491-3p	CLIP-seq
MIRT2496992	hsa-miR-513c	CLIP-seq
MIRT2496993	hsa-miR-514b-5p	CLIP-seq
MIRT864062	hsa-miR-518d-5p	CLIP-seq
MIRT864063	hsa-miR-519b-5p	CLIP-seq
MIRT864064	hsa-miR-519c-5p	CLIP-seq
MIRT864065	hsa-miR-520c-5p	CLIP-seq
MIRT2496994	hsa-miR-520d-5p	CLIP-seq
MIRT2496995	hsa-miR-524-5p	CLIP-seq
MIRT864066	hsa-miR-526a	CLIP-seq
MIRT2496996	hsa-miR-548a-3p	CLIP-seq
MIRT2496997	hsa-miR-548e	CLIP-seq
MIRT2496998	hsa-miR-548f	CLIP-seq
MIRT2496999	hsa-miR-548t	CLIP-seq
MIRT2497000	hsa-miR-548v	CLIP-seq
MIRT2193807	hsa-miR-575	CLIP-seq
MIRT2497001	hsa-miR-586	CLIP-seq
MIRT2497002	hsa-miR-596	CLIP-seq
MIRT2497003	hsa-miR-600	CLIP-seq
MIRT2496952	hsa-miR-1254	CLIP-seq
MIRT2496953	hsa-miR-1256	CLIP-seq
MIRT864040	hsa-miR-1287	CLIP-seq
MIRT1546182	hsa-miR-138	CLIP-seq
MIRT2496955	hsa-miR-153	CLIP-seq
MIRT2496956	hsa-miR-190	CLIP-seq
MIRT2496957	hsa-miR-190b	CLIP-seq
MIRT2193797	hsa-miR-2277-3p	CLIP-seq
MIRT864041	hsa-miR-24	CLIP-seq
MIRT2496960	hsa-miR-29a	CLIP-seq
MIRT2496961	hsa-miR-29b	CLIP-seq
MIRT2496962	hsa-miR-29c	CLIP-seq
MIRT2496963	hsa-miR-3116	CLIP-seq
MIRT2496964	hsa-miR-3145-3p	CLIP-seq
MIRT2496965	hsa-miR-3163	CLIP-seq
MIRT864043	hsa-miR-3176	CLIP-seq
MIRT2496966	hsa-miR-320a	CLIP-seq
MIRT2496967	hsa-miR-320b	CLIP-seq
MIRT2496968	hsa-miR-320c	CLIP-seq
MIRT2496969	hsa-miR-320d	CLIP-seq
MIRT2496970	hsa-miR-342-3p	CLIP-seq
MIRT2496971	hsa-miR-3529	CLIP-seq
MIRT2496972	hsa-miR-3607-3p	CLIP-seq
MIRT2496973	hsa-miR-3614-3p	CLIP-seq
MIRT864045	hsa-miR-3616-3p	CLIP-seq
MIRT864046	hsa-miR-3652	CLIP-seq
MIRT2193800	hsa-miR-3672	CLIP-seq
MIRT2496974	hsa-miR-370	CLIP-seq
MIRT2496975	hsa-miR-379	CLIP-seq
MIRT864050	hsa-miR-3922-3p	CLIP-seq
MIRT2496976	hsa-miR-4254	CLIP-seq
MIRT2496977	hsa-miR-4317	CLIP-seq
MIRT2496978	hsa-miR-4429	CLIP-seq
MIRT864051	hsa-miR-4430	CLIP-seq
MIRT864052	hsa-miR-4437	CLIP-seq
MIRT2496979	hsa-miR-4451	CLIP-seq
MIRT2496980	hsa-miR-4532	CLIP-seq
MIRT864054	hsa-miR-455-5p	CLIP-seq
MIRT2496981	hsa-miR-4639-5p	CLIP-seq
MIRT2496982	hsa-miR-4649-3p	CLIP-seq
MIRT2496983	hsa-miR-4650-3p	CLIP-seq
MIRT2496984	hsa-miR-4656	CLIP-seq
MIRT2496985	hsa-miR-4663	CLIP-seq
MIRT2193804	hsa-miR-4676-5p	CLIP-seq
MIRT2496986	hsa-miR-4685-5p	CLIP-seq
MIRT2496987	hsa-miR-4688	CLIP-seq
MIRT864059	hsa-miR-4721	CLIP-seq
MIRT2496988	hsa-miR-4728-3p	CLIP-seq
MIRT864060	hsa-miR-4757-5p	CLIP-seq
MIRT2496989	hsa-miR-4763-5p	CLIP-seq
MIRT2496990	hsa-miR-4768-5p	CLIP-seq
MIRT1956146	hsa-miR-4795-3p	CLIP-seq
MIRT2496991	hsa-miR-491-3p	CLIP-seq
MIRT2496992	hsa-miR-513c	CLIP-seq
MIRT2496993	hsa-miR-514b-5p	CLIP-seq
MIRT864062	hsa-miR-518d-5p	CLIP-seq
MIRT864063	hsa-miR-519b-5p	CLIP-seq
MIRT864064	hsa-miR-519c-5p	CLIP-seq
MIRT864065	hsa-miR-520c-5p	CLIP-seq
MIRT864066	hsa-miR-526a	CLIP-seq
MIRT2496996	hsa-miR-548a-3p	CLIP-seq
MIRT2496997	hsa-miR-548e	CLIP-seq
MIRT2496998	hsa-miR-548f	CLIP-seq
MIRT2193807	hsa-miR-575	CLIP-seq
MIRT2497001	hsa-miR-586	CLIP-seq
MIRT2497002	hsa-miR-596	CLIP-seq
MIRT2497003	hsa-miR-600	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ING1	Activation	15662138
ING4	Activation	19895734
NFKB1	Unknown	20056115
PHF10	Unknown	20530714
PML	Activation	16253165
RELA	Unknown	20056115
RUNX3	Activation	15930301;19290488
SIM2	Activation	21729534
SP1	Unknown	11773055
TP53	Unknown	21859835

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001554	Process	Luteolysis	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0002020	Function	Protease binding	IEA
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	16920334, 19240112, 21726810, 24904167
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA
GO:0005123	Function	Death receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	7596430, 9208847, 9736630, 11257232, 15246877, 16227597, 16501604, 16530191, 17167422, 17544405, 17606900, 17823127, 18723680, 19273858, 21726810, 23150525, 25241761, 28514442, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	17167422
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA	17167422, 17823127, 22253444
GO:0005829	Component	Cytosol	TAS
GO:0006309	Process	Apoptotic DNA fragmentation	TAS
GO:0006508	Process	Proteolysis	IDA	12888622, 17553422
GO:0006915	Process	Apoptotic process	IBA	21873635
GO:0006915	Process	Apoptotic process	IMP	15565177
GO:0006974	Process	Cellular response to DNA damage stimulus	IEA
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007507	Process	Heart development	IEA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008233	Function	Peptidase activity	IDA	9353287, 17167422, 19740745
GO:0008627	Process	Intrinsic apoptotic signaling pathway in response to osmotic stress	IEA
GO:0009411	Process	Response to UV	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0010165	Process	Response to X-ray	IEA
GO:0016005	Function	Phospholipase A2 activator activity	IEA
GO:0016241	Process	Regulation of macroautophagy	TAS	19549685
GO:0016485	Process	Protein processing	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0021766	Process	Hippocampus development	IEA
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0030216	Process	Keratinocyte differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	IBA	21873635
GO:0030218	Process	Erythrocyte differentiation	IDA	17167422
GO:0030218	Process	Erythrocyte differentiation	TAS	18309324
GO:0030220	Process	Platelet formation	TAS	18309324
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0031264	Component	Death-inducing signaling complex	IEA
GO:0031647	Process	Regulation of protein stability	IDA	17553422
GO:0032025	Process	Response to cobalt ion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034349	Process	Glial cell apoptotic process	IEA
GO:0034612	Process	Response to tumor necrosis factor	TAS	10521396
GO:0035094	Process	Response to nicotine	IEA
GO:0035329	Process	Hippo signaling	TAS
GO:0042060	Process	Wound healing	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IGI	9353287
GO:0043200	Process	Response to amino acid	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0046007	Process	Negative regulation of activated T cell proliferation	IEA
GO:0046677	Process	Response to antibiotic	IEA
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IDA	23954828
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0061713	Process	Anterior neural tube closure	IEA
GO:0071887	Process	Leukocyte apoptotic process	IEA
GO:0072734	Process	Cellular response to staurosporine	IMP	22253444
GO:0097153	Function	Cysteine-type endopeptidase activity involved in apoptotic process	IBA	21873635
GO:0097153	Function	Cysteine-type endopeptidase activity involved in apoptotic process	IDA	23729654
GO:0097153	Function	Cysteine-type endopeptidase activity involved in apoptotic process	IMP	10921886
GO:0097190	Process	Apoptotic signaling pathway	TAS	10521396
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	TAS
GO:0097194	Process	Execution phase of apoptosis	IDA	8689682
GO:0097194	Process	Execution phase of apoptosis	IMP	11350920
GO:0097194	Process	Execution phase of apoptosis	TAS
GO:0097199	Function	Cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	21980415
GO:0097200	Function	Cysteine-type endopeptidase activity involved in execution phase of apoptosis	IMP	17559062, 22253444
GO:1902004	Process	Positive regulation of amyloid-beta formation	IDA	17553422

Other IDs

• MIM: 600636
• HGNC: 1504
• e!Ensembl: ENSG00000164305

Protein

• UniProt ID: P42574
• Protein name: Caspase-3 (CASP-3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP-32) (Protein Yama) (SREBP cleavage activity 1) (SCA-1) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]
• Protein function: Thiol protease that acts as a major effector caspase involved in the execution phase of apoptosis (PubMed:18723680, PubMed:20566630, PubMed:23650375, PubMed:35338844, PubMed:35446120, PubMed:7596430). Following cleavage and activation by initiat
• PDB: 1CP3, 1GFW, 1I3O, 1NME, 1NMQ, 1NMS, 1PAU, 1QX3, 1RE1, 1RHJ, 1RHK, 1RHM, 1RHQ, 1RHR, 1RHU, 2C1E, 2C2K, 2C2M, 2C2O, 2CDR, 2CJX, 2CJY, 2CNK, 2CNL, 2CNN, 2CNO, 2DKO, 2H5I, 2H5J, 2H65, 2J30, 2J31, 2J32, 2J33, 2XYG, 2XYH, 2XYP, 2XZD, 2XZT, 2Y0B, 3DEH, 3DEI, 3DEJ, 3DEK, 3EDQ, 3GJQ, 3GJR, 3GJS, 3GJT, 3H0E, 3ITN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00656	Peptidase_C14	45 → 275		Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in lung, spleen, heart, liver and kidney. Moderate levels in brain and skeletal muscle, and low in testis. Also found in many cell lines, highest expression in cells of the immune system. {ECO:0000269|PubMed:7983002}.
• Sequence:

  MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
  MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
  HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
  DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
  RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

• Sequence length: 277

Pathways

KEGG:

Platinum drug resistance
MAPK signaling pathway
p53 signaling pathway
Efferocytosis
Apoptosis
Apoptosis - multiple species
Cytosolic DNA-sensing pathway
Natural killer cell mediated cytotoxicity
IL-17 signaling pathway
TNF signaling pathway
Serotonergic synapse
Non-alcoholic fatty liver disease
AGE-RAGE signaling pathway in diabetic complications
Alcoholic liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Legionellosis
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Lipid and atherosclerosis

Reactome:

Activation of caspases through apoptosome-mediated cleavage
Apoptotic cleavage of cellular proteins
SMAC, XIAP-regulated apoptotic response
Apoptosis induced DNA fragmentation
Signaling by Hippo
NADE modulates death signalling
Caspase-mediated cleavage of cytoskeletal proteins
Apoptotic cleavage of cell adhesion proteins
Caspase activation via Dependence Receptors in the absence of ligand
Other interleukin signaling

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	18077176
Cryptorchidism	Cryptorchidism, Bilateral Cryptorchidism, Unilateral Cryptorchidism, Abdominal Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886	26050606
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	15531508
Retinal detachment	Retinal Detachment	rs1555976049, rs1592230091	18497877
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20580881
Tumoral calcinosis	Tumoral calcinosis	rs104894343, rs104894344, rs745655924, rs137853086, rs375879489, rs761396172, rs137853087, rs137853091, rs137853088, rs137853089, rs137853090, rs766750282, rs760830864, rs786205250, rs267606841, rs1555096583, rs1220533001, rs762936774, rs775341386	21335463

Unknown
Disease term	Disease name	Evidence	References	Source
Myocardial infarction	Myocardial Infarction		25450231	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
Abortion Spontaneous	Associate	23218678
Acquired ichthyosis	Associate	28402449
Acquired Immunodeficiency Syndrome	Associate	11861282
Acrocephalosyndactylia	Stimulate	23330016, 23404329
Acute Coronary Syndrome	Associate	29962384
Adenocarcinoma	Associate	15163235, 20076902, 27723786, 35986318
Adenocarcinoma of Lung	Associate	12576296, 20150439, 20885442, 22471490, 24972691, 27706758, 38182570
Adenoma	Stimulate	34762658
Adenoma Pleomorphic	Associate	25230790
Adrenocortical Carcinoma	Associate	35848940
Aggressive Periodontitis	Associate	16787530
Airway Obstruction	Associate	19107589
Alexander Disease	Associate	21756903, 31611638
Altitude Sickness	Stimulate	29357502
Alzheimer Disease	Associate	10550301, 12408229, 28985224, 29027727, 30611996, 32437347, 37553376, 38049398, 40363838
Alzheimer Disease	Stimulate	10582585, 18818379, 22307387, 40599432
Amyloid Neuropathies Familial	Stimulate	11567048
Amyloidosis	Associate	12408229
Amyotrophic Lateral Sclerosis	Associate	22764223
Amyotrophic Lateral Sclerosis	Stimulate	26159164
Anemia Hemolytic	Associate	15257717
Anemia Sickle Cell	Inhibit	17711515
Angiomyolipoma	Associate	22791333
Anterior Cruciate Ligament Injuries	Associate	26762166
Anxiety Disorders	Associate	33849116
Aortic Aneurysm Thoracic	Associate	22978789
Aortic Dissection	Associate	22978789
Aortic Valve Disease	Associate	23968872
Arthritis	Stimulate	36982526
Arthritis Rheumatoid	Associate	10817565, 19171073, 21923740, 23308194, 24452947, 24920239, 30352835, 32584515, 32692720, 33087158, 34766472
Ascites	Associate	29549251
Astrocytoma	Associate	15112054, 32446712
Ataxia	Associate	18160752, 18182848
Ataxia Telangiectasia	Associate	11382748
Atherosclerosis	Associate	24252910
Atrial Fibrillation	Associate	10551709
Autism Spectrum Disorder	Associate	36401485
Azoospermia	Associate	18177647
Bacterial Infections	Stimulate	24223971
Barth Syndrome	Associate	22023389
Behcet Syndrome	Associate	15986355
Binge Drinking	Stimulate	12603597
Bipolar Disorder	Associate	19945534
Bipolar Disorder	Stimulate	28463235
Blister	Associate	27868136
Bloom Syndrome	Associate	11470874
Bohring syndrome	Associate	22048168
Brain Diseases	Associate	35848940
Brain Neoplasms	Associate	18720359, 23271051
Brain Neoplasms	Stimulate	33501557
Breast Neoplasms	Associate	10371215, 11571297, 12644829, 14725611, 15163235, 15767684, 15830342, 16309219, 17490757, 18690087, 18820371, 19047049, 19223905, 19242112, 19245689, 19342873, 20150224, 20348950, 20955597, 21068479, 21127496, 21282976, 21901386, 22126498, 22216167, 23370279, 24347041, 24553912, 24896091, 24947113, 24952432, 25169499, 25190016, 25220225, 25268975, 25419573, 26011589, 26225696, 26383236, 27221871, 27798717, 27995416, 28987049, 30259091, 30290054, 30485942, 30873742, 31578772, 32186756, 32658903, 32705365, 32746451, 32766303, 33369440, 33369470, 33519190, 34369076, 34452574, 35291987, 36615253, 36765397, 36882618, 37116152, 37682166, 39844241, 40252335, 40390653
Breast Neoplasms	Stimulate	17567922, 34360714
Bulbo Spinal Atrophy X Linked	Associate	11335100, 9813160
Burkitt Lymphoma	Associate	18754867, 22131152, 22241218, 33325535, 37569852
Burns	Associate	27350317
C9 Deficiency	Associate	33362237
Calcinosis Cutis	Associate	21513580
Cap Myopathy	Associate	23475579
Carcinogenesis	Associate	18829519, 22901190, 25737553, 27556207, 27723786, 27798717, 28691902, 28700659
Carcinoid Tumor	Associate	19765735
Carcinoma Adenoid Cystic	Associate	18601533, 27061543
Carcinoma Basal Cell	Associate	24927175
Carcinoma Hepatocellular	Associate	10884382, 12970919, 15098015, 15160348, 15378770, 16627981, 17695528, 18700866, 19140237, 19671867, 20345480, 23830978, 24287949, 24969544, 25260879, 25261655, 25403108, 25543761, 25755779, 26670903, 26718026, 26758428, 27255186, 27468214, 28350813, 28453560, 28534955, 28638890, 28677801, 29476051, 29523220, 29694502, 29749446, 29768061, 30443188, 31300048, 33294448, 33576897, 33642822, 33776365, 33883691, 33902004, 35127170, 35242200, 35572840, 36037300, 36351994, 38019231, 39256453, 40302327
Carcinoma Non Small Cell Lung	Associate	10817513, 11828291, 18720359, 20494979, 21077998, 21744322, 21801305, 22438908, 22568453, 23082969, 24367688, 24626292, 26768747, 26959116, 29642873, 29901106, 31115507, 32337219, 32705266, 33300085, 33562773, 34794242, 34862113, 35136416, 37606338, 39258670
Carcinoma Ovarian Epithelial	Associate	30178832, 31210304
Carcinoma Pancreatic Ductal	Associate	33850476
Carcinoma Renal Cell	Associate	33302576, 33759378, 34781823, 35414767
Carcinoma Squamous Cell	Associate	22307387, 25330158, 27556207, 28114230, 33896245
Cardiomyopathies	Associate	12181128
Cardiomyopathies	Stimulate	12907417
Cardiomyopathy Dilated	Associate	12181128, 25888309
Cartilage Diseases	Associate	11779095
Cataract	Associate	26956740
Celiac Disease	Associate	23991739, 37455655
Cerebral Infarction	Inhibit	27776139
Charcot Marie Tooth disease Type 1C	Stimulate	36614264
Cholangiocarcinoma	Associate	28662515, 32246704, 34181351, 35683032
Cholangiocarcinoma	Stimulate	39344395
Choriocarcinoma	Associate	27983929
Chromosome 8 trisomy	Associate	12393649
Chronic Disease	Stimulate	21262580
Chronobiology Disorders	Associate	19940360
Churg Strauss Syndrome	Associate	17265502
Clear cell metastatic renal cell carcinoma	Associate	33759378
Cleft Palate	Associate	26795696
Cognition Disorders	Associate	36455873
Cognitive Dysfunction	Associate	33447019
Colitis	Associate	29922282, 35085569
Colitis Ulcerative	Associate	31159239, 37078344
Colonic Neoplasms	Associate	24317430, 30088538, 31040202
Colorectal Neoplasms	Associate	10915781, 11351040, 12033956, 16433033, 17201158, 17395183, 17436592, 19137010, 20930850, 21403907, 22481083, 22536331, 23591201, 23893182, 24992592, 25197379, 25684945, 25906152, 25986235, 26844701, 27055667, 27235711, 27461654, 28143990, 28972559, 29393430, 29524226, 29801534, 30361551, 30477538, 31199053, 31633448, 32000660, 32277680, 32495637, 33878735, 34512817, 35468741, 37516866, 37530327, 37658940, 37933160
Common Variable Immunodeficiency	Associate	30464201
Communicable Diseases	Associate	32873094
Coronary Artery Disease	Associate	21889313, 23894522, 26263983, 33593717, 34309093
COVID 19	Associate	33029094, 33248385, 34585746, 36334414, 36736734, 37109672, 37896870
COVID 19	Stimulate	34076792, 35321977
Coxa Magna	Associate	35118903
Craniosynostoses	Stimulate	29847820
Crohn Disease	Stimulate	31159239
Death	Associate	10944606, 12070005, 12414525, 12867423, 22452992, 23091605, 23805285, 9310497
Diabetes Mellitus	Associate	19175688, 23335850, 26782377, 29302057, 34140543, 34309093
Diabetes Mellitus	Stimulate	21549702, 31587010
Diabetes Mellitus	Inhibit	29072691
Diabetes Mellitus Type 1	Associate	34697343
Diabetes Mellitus Type 2	Associate	30024959, 34309093, 36736734
Diabetes Mellitus Type 2	Stimulate	30593206
Diabetic Foot	Associate	34293021
Diabetic Nephropathies	Associate	35843953, 35932042, 37986381
Diabetic Retinopathy	Associate	31799636
Disease Resistance	Associate	9642215
DNA Virus Infections	Associate	21068357
Down Syndrome	Associate	10550301
Drug Related Side Effects and Adverse Reactions	Associate	10323451, 10891490, 10984607, 12824190, 16834771, 17823654, 18375382, 18664592, 20032392, 20138029, 21470196, 21746806, 22336595, 23709189, 24989254, 26229578, 30343279, 31786278, 32711410, 33114015, 33189883, 36768617
Drug Related Side Effects and Adverse Reactions	Stimulate	14725611, 15059848, 15795449, 20044605, 20860474, 23555722, 25196936, 26557712, 30295086, 32862611, 33466812, 35952447
Dysentery Bacillary	Associate	12011015
Dysequilibrium syndrome	Associate	32572905, 37052975
Dyskinesias	Associate	27556207
Dyslipidemias	Stimulate	37531036
Edema	Associate	31293101
Ehrlichiosis	Stimulate	10772341
Emphysematous Cholecystitis	Associate	15684288
Encephalitis	Associate	26092112
Endometrial Hyperplasia	Stimulate	21171931
Endometrial Neoplasms	Associate	19531679, 21888833, 28421904, 30628640, 31127027, 32407273, 35442481, 35725817
Endometriosis	Associate	34746304
Ependymoma	Associate	20184588
Epilepsy	Associate	32219137, 37833937
Epstein Barr Virus Infections	Associate	37839162
Esophageal Neoplasms	Associate	16425431, 22136337, 23820115
Esophageal Squamous Cell Carcinoma	Associate	22136337, 24764681, 27723786, 28277193, 32071920, 33650646
Esophagitis	Associate	22901192
Fallopian Tube Diseases	Associate	34746304
Familial cylindromatosis	Stimulate	32901872
Fanconi Anemia	Associate	20068062, 34954697
Farber Lipogranulomatosis	Associate	10653586
Fatty Liver	Associate	25400762, 36083487
Fetal Growth Retardation	Associate	15502418
Fetal Membranes Premature Rupture	Stimulate	30536268
Fever	Stimulate	11861640, 19035282, 25268613, 29554655, 34066632
Fever	Associate	17989736
Fever	Inhibit	29901106
Fibrocartilaginous embolism	Associate	25561896, 30936926, 32196619, 33734570
Fibrosis	Associate	37179298
Focal Cortical Dysplasia	Associate	37833937
Focal cortical dysplasia of Taylor	Stimulate	23586324
Focal Epithelial Hyperplasia	Associate	10574243
Frontotemporal Dementia	Associate	32727073
Gallbladder Neoplasms	Associate	24009453, 29513793
Gastrointestinal Neoplasms	Associate	32883271
Glioblastoma	Associate	11772428, 11883844, 18669646, 20730317, 21508666, 24213561, 24561085, 24805821, 28656196, 29236891, 29780826, 30852975, 31073903, 31390836, 32210117, 32446712, 32504326, 32565597, 34784707, 35658846, 35918659, 35977996, 36838582, 40133216
Glioma	Associate	15523899, 17804742, 18669646, 19001440, 23035900, 23280445, 25355637, 25532840, 25755779, 26223576, 26748401, 27893811, 29164574, 29866060, 30537994, 30927504, 33920356, 35848940, 35981653, 36570001, 36795994, 37918583
Glioma	Inhibit	29316313
Glomerulonephritis IGA	Stimulate	21974877
Glomerulosclerosis Focal Segmental	Associate	33147279
Glucosephosphate Dehydrogenase Deficiency	Associate	24223971
Glycogen Storage Disease Type II	Associate	24581426
Goiter	Associate	21180995
Goiter Nodular	Associate	21180995
Granulosa Cell Tumor	Associate	31412918
Granulosa cell tumor of the ovary	Associate	26261481
Graves Ophthalmopathy	Stimulate	36561758
Hamartoma Syndrome Multiple	Associate	36543932
Hand Arm Vibration Syndrome	Associate	38302542
Hashimoto Disease	Associate	36807042
Head and Neck Neoplasms	Stimulate	22307387
Head and Neck Neoplasms	Associate	23271051, 37371038
Hearing Loss Noise Induced	Associate	28738811, 37815076
Heart Diseases	Associate	20022263
Heart Failure	Stimulate	18279768
Heart Failure	Associate	29847820
Helicobacter Infections	Associate	32820150
Hematologic Diseases	Associate	22568453
Hematologic Neoplasms	Associate	27742710
Hemolytic Uremic Syndrome	Associate	9840908
Hepatitis B	Associate	32293395
Hepatitis C Chronic	Associate	32050950
Hereditary Breast and Ovarian Cancer Syndrome	Associate	10574243
Hereditary leiomyomatosis and renal cell cancer	Associate	12070005
HIV Infections	Associate	11861282, 12750404, 19414397, 27549585, 30413535
HIV Infections	Stimulate	20962079
HIV Seropositivity	Stimulate	30779672
Hodgkin Disease	Associate	10329597, 11376869, 12070005, 9310497
HTLV I Infections	Associate	22496955
Huntington Disease	Associate	36902304
Hyperglycemia	Stimulate	23985558
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	28942148
Hypertension	Stimulate	17558734
Hypothermia	Inhibit	19596001
Hypoxia	Associate	12181128, 17273772, 17600131, 19794957, 23485709, 26464645, 28402449, 32296107, 32351020, 35409364, 39519249
Hypoxia	Stimulate	18326038, 22087251, 25684163, 25849550, 29357502, 29790920, 30355438, 31992313, 33174051
Hypoxia	Inhibit	19919574, 29466367
Hypoxia Brain	Stimulate	15613236, 30755679
Hypoxia Brain	Associate	28394473, 30137220, 31364726
Hypoxia Ischemia Brain	Associate	35170135
Idiopathic Interstitial Pneumonias	Associate	12480919
Idiopathic Pulmonary Fibrosis	Associate	11334117, 18635891, 23580232
Idiopathic Pulmonary Fibrosis	Stimulate	34209019
IgA Vasculitis	Associate	16734620, 19171073
Infections	Associate	11447179, 16608851, 22496955, 22699519, 25090990, 29126418, 30918127, 36516338
Infections	Inhibit	15781584
Infections	Stimulate	17130252, 33207682, 37227036
Infertility	Inhibit	23218678
Inflammation	Associate	12011015, 19178812, 19355923, 24283517, 28985224, 29079763, 29694513, 30298576, 30338821, 31607744, 32321531, 33677475, 36918905, 37192896
Influenza Human	Associate	23731466
Intervertebral Disc Degeneration	Associate	18302283, 34805401
Intervertebral Disc Degeneration	Stimulate	33090383
Intestinal Diseases	Associate	17557866
Intestinal Neoplasms	Stimulate	16714395
Iron Deficiencies	Inhibit	37087978
Iron Overload	Associate	36611912
Kartagener Syndrome	Stimulate	21875297
Kidney Diseases	Associate	33138038
Kidney Neoplasms	Associate	29131025, 31424686
Laryngeal Neoplasms	Associate	28455995
Leiomyoma	Associate	28483502, 29523174, 30503138
Leiomyosarcoma	Associate	22556343
Leukemia	Associate	10989191, 11238127, 15171819, 15843042, 16595897, 16769721, 17561974, 17603173, 17993614, 19809251, 20105315, 20704577, 21190589, 21881314, 22412883, 22496955, 24016597, 24099795, 30088262, 33924032, 36585521, 37630388
Leukemia Lymphocytic Chronic B Cell	Inhibit	12176903, 25499217
Leukemia Lymphocytic Chronic B Cell	Associate	15521917, 15621735, 15914559, 20628148, 26220042, 31681329, 9558396
Leukemia Lymphoma Adult T Cell	Associate	16497974, 18434687, 26497583
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	12714496, 19363496, 20704577, 22833150, 25166742, 26629937, 34673425
Leukemia Myeloid	Associate	20640151
Leukemia Myeloid Acute	Associate	11090079, 12576328, 18160664, 19463775, 19652057, 20557671, 21595920, 21695163, 21998731, 22308476, 23320127, 31114982, 31831875, 32783661, 34895042, 35873796, 38085150
Leukemia Promyelocytic Acute	Associate	12926551, 17201156, 24356076, 30551620, 30825052, 9489995, 9746761, 9920855
Leukemia T Cell	Associate	10944606, 9409752
Leukoencephalopathies	Associate	33189883
Leukopenia	Associate	33280276
Lewy Body Disease	Associate	34686734
Lichen Planus Oral	Associate	36788511
Lip Neoplasms	Associate	27556207
Liposarcoma Myxoid	Associate	20863376
Liver Failure	Associate	12393901
Liver Neoplasms	Associate	28270653, 29901131
Lung Diseases	Associate	17586700, 18468406
Lung Neoplasms	Associate	10733772, 15152940, 18008356, 18612434, 20661084, 24441772, 26307684, 26647102, 27723786, 29565268, 29970649, 30332761, 30443171, 34553845, 35898682, 37984526, 38554387
Lupus Erythematosus Cutaneous	Associate	33931094
Lupus Erythematosus Systemic	Stimulate	16116236, 18507053, 22940256
Lupus Erythematosus Systemic	Associate	19644848, 27183584
Lymphatic Metastasis	Associate	19140237, 22302483, 25197379, 33501557
Lymphoma	Associate	12897143, 15576477, 19223368, 22496955, 30088262, 30266952
Lymphoma B Cell	Associate	10552963, 11222383, 24039967, 26666826
Lymphoma B Cell	Inhibit	22692727
Lymphoma B Cell Marginal Zone	Inhibit	16648871
Lymphoma Follicular	Associate	12756297, 24660851, 37824846
Lymphoma Large B Cell Diffuse	Associate	34928233
Lymphoma Large Cell Anaplastic	Associate	12036886, 14657946, 22365399
Lymphoma Non Hodgkin	Associate	15988143, 16802364, 23474846, 26062471, 27764808, 29391535
Lymphoma T Cell	Associate	28950914, 35014680, 37160920
Lymphoma T Cell Cutaneous	Associate	18496567
Lymphopenia	Associate	16182592
Malaria Cerebral	Stimulate	23890318
Malaria Cerebral	Associate	35151337
Malformations of Cortical Development Group I	Associate	10454555, 11031081, 11414470, 12522004, 14617628, 14997934, 15536083, 15561702, 19557855, 19632256, 21878650, 22728051, 23193212, 24809452, 26354378, 28638870, 29070760, 32125086, 32229084, 34547186, 35170135, 36973772, 36982788
Malformations of Cortical Development Group I	Stimulate	11776436, 19341237, 25948110
Malnutrition	Stimulate	31992313
Medulloblastoma	Associate	15999545, 19887560, 27537345, 35593307
Melanoma	Stimulate	11369232, 32236901, 38166464
Melanoma	Associate	11511312, 21547369, 21924824, 23527236, 25016296, 28208804, 30866426, 30989459, 31292999, 31778440, 33046735, 33573155, 33833342, 36241419, 37156818
Melanoma Cutaneous Malignant	Associate	37950289
Meningioma	Associate	17181554, 25247996, 26240495
Mesothelioma Malignant	Associate	24924397, 29748013
Mitochondrial complex I deficiency	Stimulate	12437580
Mitochondrial Diseases	Associate	22994717, 24920239, 25879420, 27223122, 28441753, 29424907, 38272357
Mitochondrial Diseases	Stimulate	24099795, 32286137, 32733636
Mitochondrial Diseases	Inhibit	29516570
Motor Neuron Disease	Associate	37010860
Mouth Diseases	Associate	34762658
Mouth Neoplasms	Associate	23212344, 24337492, 27556207, 27827950, 27941877, 34318593, 35268676, 35328402
Mouth Neoplasms	Stimulate	26595239
Mucocutaneous Lymph Node Syndrome	Associate	20423928, 23894522, 24903211
Mucocutaneous Lymph Node Syndrome	Stimulate	37506144
Mucopolysaccharidosis IV	Associate	37762422
Multiple Myeloma	Associate	10720689, 12100143, 12531793, 15070698, 15626742, 17910628, 18381704, 20860474, 20953137, 22142798, 22471522, 26724804, 27902770, 28270494, 29486474, 29562955, 31564190, 31918281, 34584036, 37628771
Multiple Myeloma	Inhibit	12393500, 18381704
Multiple Myeloma	Stimulate	28264449
Multiple Sclerosis	Inhibit	12359060
Multiple Sclerosis	Associate	19604093
Muscle Neoplasms	Associate	34705620
Muscular Atrophy Spinal	Stimulate	22723941
Muscular Atrophy Spinal	Associate	40018937
Myasthenia Gravis	Associate	17354625
Myelodysplastic Syndromes	Inhibit	11882355
Myelodysplastic Syndromes	Associate	27665715
Myocardial Infarction	Associate	29197221, 35757636
Myocardial Ischemia	Associate	40620566
Myocardial Stunning	Associate	15193679
Myocarditis	Associate	17007104
Myoclonic Epilepsies Progressive	Associate	9361003
Myopathy Granulovacuolar Lobular with Electrical Myotonia	Associate	10550301
Myxoma	Associate	15696123
Nasal Polyps	Inhibit	29306235
Nasopharyngeal Carcinoma	Associate	15330177, 15803189, 24961145, 25337187, 29256858, 30844723, 31566021, 31991751, 32448862
Nasopharyngeal Neoplasms	Associate	36225172
Necrosis	Associate	10944606, 11414470, 18669646, 20637078, 20816779, 24623967, 25906152, 29079763, 31293101
Neonatal herpes	Inhibit	25005804
Neoplasm Metastasis	Associate	17406026, 24921663, 29524226, 31356195, 35414767
Neoplasm Metastasis	Inhibit	24347041
Neoplasm Metastasis	Stimulate	24764681
Neoplasms	Associate	10706869, 10732775, 11346469, 11351040, 12036886, 12070005, 12499637, 12854132, 15098015, 15141159, 15163235, 15545229, 15653686, 15803189, 15999545, 16049281, 16251631, 16545117, 16595897, 16619569, 16711514, 16929248, 17014711, 17201158, 17490757, 17557866, 17695541, 17908973, 18305405, 18381704, 18590547, 19117056, 19241192, 19414397, 19531679, 19549763, 19671764, 19676053, 19934968, 20371723, 20406824, 20700044, 21340229, 21455217, 21744322, 22136337, 22365399, 22496955, 22699519, 22785533, 23010348, 23392175, 23417336, 23634213, 23722133, 23807226, 23936501, 23972240, 24346802, 24347041, 24422969, 24622841, 24646305, 24838641, 25053517, 25100434, 25166742, 25197379, 25374189, 25986235, 26253167, 26507126, 26581978, 26758428, 26768747, 26795696, 26850040, 26925667, 27061543, 27089328, 27322225, 27854258, 27906967, 27941877, 28114230, 28453560, 28700659, 29524226, 29749446, 29801534, 29901131, 30019295, 30055105, 30066852, 30181562, 30518159, 30835081, 30915747, 31443721, 31578772, 31581581, 31633448, 31892693, 32286137, 32293395, 32521928, 32707717, 32764438, 33025777, 33114598, 33211707, 33294448, 33302576, 33339164, 33503939, 33906066, 33930385, 34155232, 34553845, 34856000, 34908512, 35154495, 35154614, 35275451, 35363355, 35447298, 35566235, 35613525, 35692123, 35848940, 35974187, 36012549, 36080186, 36139362, 36158891, 36329448, 36482061, 36575196, 36710483, 36768617, 36838715, 37119817, 37443405, 39272099, 9497101
Neoplasms	Stimulate	17567922, 20412129, 27009166, 27235711, 32862475, 36084486
Neoplasms	Inhibit	21933904, 22412883, 25561801, 26513170, 27221871, 32685475, 36430918
Neoplasms Cystic Mucinous and Serous	Associate	21317880
Neoplasms Second Primary	Associate	23271051
Neoplasms Squamous Cell	Associate	28114230, 31257524
Nephrosis Lipoid	Associate	33147279
Nerve Degeneration	Associate	18818379, 22307387, 34571838, 36220610
Neuroblastoma	Associate	10567913, 11953454, 12378022, 14617628, 15961390, 18379052, 19308291, 20044605, 21298033, 23710710, 26208481, 26883171, 38282862
Neurofibroma	Associate	24346802
Neurofibrosarcoma	Associate	24346802
Neuronal intestinal pseudoobstruction	Associate	12580546
Neurotoxicity Syndromes	Associate	18248610, 28985224, 29334833, 30850243, 39242776
Neutropenia	Associate	22023389
NOG Related Symphalangism Spectrum Disorder	Associate	12651606
Non alcoholic Fatty Liver Disease	Stimulate	20888662
Non alcoholic Fatty Liver Disease	Associate	28216552, 29079763, 36451177, 37156902, 37861538
Nose Diseases	Associate	29306235
Obesity	Associate	22836687, 23193206, 27900559
Obesity	Stimulate	27481183, 37991453
Optic Nerve Diseases	Associate	22126795
Osteitis Deformans	Associate	19925894
Osteoarthritis	Associate	10088775, 11779095, 23603903, 28805067, 32767319, 33468167, 33677475, 34496641, 35069930
Osteoarthritis	Stimulate	31762289
Osteoglophonic dwarfism	Associate	28790819
Osteoglophonic dwarfism	Stimulate	31564830, 33355373, 36372373, 36496986
Osteoporosis	Associate	35069454, 35990678, 36626454, 38129425
Osteosarcoma	Associate	20459702, 22231496, 25339006, 25677904, 26351207, 26569226, 29750154, 30015899, 30403180, 31433581, 32075661, 32721630, 38297292
Ovarian Diseases	Associate	37883761
Ovarian Neoplasms	Associate	16882668, 22110186, 22843880, 23345014, 23762410, 24842412, 24921663, 25143136, 25313764, 25509983, 26067645, 28440479, 30197345, 30621740, 31043579, 31424650, 31702036, 31983100, 32502299
Ovarian Neoplasms	Inhibit	28537902, 36849137
Overweight	Stimulate	27481183
Pancreatic Carcinoma	Associate	20466402
Pancreatic Neoplasms	Associate	11572767, 14669326, 16425399, 21714853, 21909380, 21931488, 22320973, 26247574, 26675757, 27721241, 27756327, 27936114, 30400136, 32186702, 33020506, 35383226
Pancreatic Neoplasms	Stimulate	34155232
Parkinson Disease	Associate	11031081, 12437580, 12867415, 36501032, 37051183
Parkinson Disease	Stimulate	25645462
Parvoviridae Infections	Stimulate	9765434
pediatric multisystem inflammatory disease COVID 19 related	Associate	37896870
Pelvic Organ Prolapse	Associate	29230415, 34176919
Pemphigoid Bullous	Associate	27868136
Pemphigus	Associate	39201550
Penile Induration	Associate	23356197
Peri Implantitis	Associate	34273529
Periapical Diseases	Associate	23264211
Periodontitis	Associate	19309556, 24631628, 30593206, 35844512, 35990678
Pneumonia	Associate	37109672
Polycystic Ovary Syndrome	Associate	18073308, 33287836
Polycystic Ovary Syndrome	Inhibit	35393909
Post Infectious Disorders	Associate	22303462
Postoperative Cognitive Complications	Stimulate	29949172
Pre Eclampsia	Associate	15502418
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	16225771, 17082584
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	15142883, 20533075, 23753023, 34695805
Precursor Cell Lymphoblastic Leukemia Lymphoma	Stimulate	26506264
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16281935, 24708856, 37302808
Primary Ovarian Insufficiency	Associate	40696610
Prostatic Hyperplasia	Associate	28327526, 37378942
Prostatic Intraepithelial Neoplasia	Associate	16545117
Prostatic Neoplasms	Associate	12771931, 15274298, 15548330, 16687488, 16880611, 19055752, 20574155, 21545229, 22564737, 22844442, 23076676, 23886135, 24267199, 26507126, 26823716, 27187384, 28415720, 28737827, 29767250, 30378157, 30864712, 31389609, 31389670, 32341393, 32427575, 34933951, 35457012, 35524874, 36364008, 36597139, 37378942, 37464317
Prostatic Neoplasms	Inhibit	24375255
Prostatic Neoplasms Castration Resistant	Associate	37047425
Prostatitis	Associate	16519808, 24375255, 28704809, 34933951
Prosthesis Failure	Associate	19214244
Psoriasis	Associate	29182760
Psoriasis	Stimulate	37531036
Pterygium	Associate	21738398
Pulmonary Disease Chronic Obstructive	Associate	25058453, 30298576
Pulmonary Disease Chronic Obstructive	Stimulate	29484832
Pulmonary Edema	Stimulate	26617708
Purine Nucleoside Phosphorylase Deficiency	Associate	35641516
Purpura Thrombocytopenic Idiopathic	Associate	30936868
Purpura Thrombotic Thrombocytopenic	Associate	9840908
Pyruvate Carboxylase Deficiency Disease	Associate	32945513
Raynaud Disease	Associate	38302542
Rectal Neoplasms	Associate	17908973
Recurrent respiratory papillomatosis	Associate	35012431
Reperfusion Injury	Associate	29461605
Reperfusion Injury	Stimulate	34694031, 38118351
Respiratory Distress Syndrome	Associate	19635508
Respiratory Tract Infections	Associate	22977664
Retinal Vein Occlusion	Associate	36180575
Retinoblastoma	Associate	27626280, 30694025, 31038819
Rhabdoid Tumor	Associate	35613525
Rhabdomyosarcoma	Associate	25871399
Riboflavin Deficiency	Stimulate	36014863
Salivary Gland Neoplasms	Associate	22313995
Sarcoma Kaposi	Associate	24027049
Seizures	Associate	32219137
Sertoli Cell Only Syndrome	Associate	17123522
Severe Acute Respiratory Syndrome	Associate	16182592, 19635508
Sezary Syndrome	Associate	14632209
Sleep Deprivation	Associate	12716464, 16101145, 9473236
Sleep Deprivation	Stimulate	21555338
Small Cell Lung Carcinoma	Stimulate	17567922
Small Cell Lung Carcinoma	Associate	32767507
Soft Tissue Injuries	Associate	39366520
Squamous Cell Carcinoma of Head and Neck	Stimulate	14511235
Squamous Cell Carcinoma of Head and Neck	Associate	17592646, 18349842, 18829519, 22307387, 23244104, 23271051, 25591548, 27644244, 28179290, 28257034, 28700659, 30733838, 31309556, 31356195, 33174023, 33501557, 34781814, 35078428, 36263558, 37798436
Status Asthmaticus	Associate	15781584
Status Asthmaticus	Stimulate	16891808, 27984639
Stomach Diseases	Associate	20065505, 30019295
Stomach Neoplasms	Associate	11146441, 12854132, 12918097, 12970879, 14695762, 14769213, 15222052, 16080516, 16440413, 18946358, 20032392, 21897022, 22090785, 22160140, 22799335, 23292941, 23326121, 23969976, 24805829, 24838641, 25040744, 25041019, 25197379, 25561801, 26147886, 26581978, 26686868, 26980707, 27384994, 28000850, 29393470, 29501797, 29960296, 30066897, 30719998, 30809951, 30915355, 31173270, 31599422, 32736677, 33000178, 33982777, 35757520, 36082059, 37401238, 37794689, 40076652
Stomach Neoplasms	Inhibit	14991928
Stomach Ulcer	Stimulate	18946358
Striae Distensae	Stimulate	28784087
Systemic carnitine deficiency	Associate	25702164
Temporomandibular Joint Dysfunction Syndrome	Associate	20839416
Testicular Germ Cell Tumor	Associate	17643097
Thrombocytopenia	Associate	16182592
Thrombotic Microangiopathies	Associate	9840908
Thyroid Cancer Papillary	Associate	21180995, 24081676, 26863116, 30964171, 32182833, 36329448
Thyroid Carcinoma Anaplastic	Associate	23569377, 26934320, 31524258
Thyroid Neoplasms	Associate	26334619, 35968508, 37532555
Tinnitus	Associate	37815076
Tongue Neoplasms	Associate	19331169, 19414420
Tonsillar Neoplasms	Associate	19178812
Tonsillitis	Associate	19178812
Triple Negative Breast Neoplasms	Associate	26909599, 31196010, 31870109, 32847857, 33302699, 33416073, 34036395, 35447298, 37093683, 37175458, 37713894, 37822991
Triple Negative Breast Neoplasms	Stimulate	36084486
Tuberculosis Multidrug Resistant	Associate	19421371, 20663232, 24805866
Tuberous Sclerosis	Stimulate	23586324
Urinary Bladder Neoplasms	Associate	11346469, 18210748, 23656495, 26873485, 28191815, 28433067, 28968601, 31769229, 32277642, 37771276, 39726319
Uterine Cervical Neoplasms	Associate	18210747, 18644986, 23152800, 24633228, 25197379, 26758418, 27363024, 27505047, 28114230, 28208804, 28438233, 28682441, 28963664, 29393414, 31180057, 31284780, 31983099, 37606138, 40603406
Uterine Diseases	Associate	21804459, 37773689
Uveal melanoma	Associate	39321515
Varicocele	Associate	31670279, 36372090
Varicose Ulcer	Associate	21262580
Varicose Veins	Associate	28818228
Vascular Diseases	Associate	27918592, 36334414
Venous Insufficiency	Stimulate	29626597
Ventricular Dysfunction Right	Associate	28361825
Viremia	Associate	20962079
Virus Diseases	Associate	32659620, 33029094
Vitreoretinopathy Proliferative	Associate	28777835
von Hippel Lindau Disease	Associate	28094316
Wiskott Aldrich Syndrome	Stimulate	10666201
Wounds and Injuries	Associate	30046375, 34116684