RTP3 (receptor transporter protein 3)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways
Entrez ID 83597
Gene name Receptor transporter protein 3
Gene symbol RTP3
Synonyms (NCBI Gene)
LTM1TMEM7Z3CXXC3
Chromosome 3
Chromosome location 3p21.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene Gene ontology Other IDs Protein Pathways
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IBA
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IDA 16720576
GO:0005515 Function Protein binding IPI 16720576
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 16720576
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
607181 15572 ENSG00000163825
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BQQ7
Protein name Receptor-transporting protein 3 (3CxxC-type zinc finger protein 3) (Transmembrane protein 7)
Protein function Promotes functional cell surface expression of the bitter taste receptors TAS2R16 and TAS2R43.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13695 zf-3CxxC 48 → 160 Zinc-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in adult liver (PubMed:11896456, PubMed:17693185). Expressed in testis (PubMed:16720576, PubMed:17693185). Also expressed in kidney, lung and fetal liver (PubMed:17693185). Low levels in heart, thyroid, adrenal
Sequence 
MAGDTEVWKQMFQELMREVKPWHRWTLRPDKGLLPNVLKPGWMQYQQWTFARFQCSSCSR
NWASAQVLVLFHMNWSEEKSRGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRILKNLVF
RILKKCYRGRFQLIEEVPMIKDISLEGPHNSDNCEACLQGFCAGPIQVTSLPPSQTPRVH
SIYKVEEVVKPWASGENVYSYACQNHICRNLSIFCCCVILIVIVVIVVKTAI
Sequence length 232
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways
  Reactome
    Olfactory Signaling Pathway