CHST9 (carbohydrate sulfotransferase 9)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83539
Gene name Gene Name - the full gene name approved by the HGNC.
Carbohydrate sulfotransferase 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CHST9
Synonyms (NCBI Gene) Gene synonyms aliases
GALNAC4ST-2, GalNAc4ST2
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans.
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT018484 hsa-miR-335-5p Microarray 18185580
MIRT048939 hsa-miR-92a-3p CLASH 23622248
MIRT892638 hsa-miR-323-3p CLIP-seq
MIRT892639 hsa-miR-3545-3p CLIP-seq
MIRT892640 hsa-miR-365 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0001537 Function N-acetylgalactosamine 4-O-sulfotransferase activity IDA 11139592, 11445554
GO:0001537 Function N-acetylgalactosamine 4-O-sulfotransferase activity ISS
GO:0005576 Component Extracellular region IEA
GO:0006790 Process Sulfur compound metabolic process IDA 11445554
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
610191 19898 ENSG00000154080
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q7L1S5
Protein name Carbohydrate sulfotransferase 9 (EC 2.8.2.-) (GalNAc-4-O-sulfotransferase 2) (GalNAc-4-ST2) (GalNAc4ST-2) (N-acetylgalactosamine-4-O-sulfotransferase 2)
Protein function Catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. Participates in biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulfation of th
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03567 Sulfotransfer_2 204 → 439 Sulfotransferase family Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in trachea. Also expressed in fetal lung, adult pancreas, testis and salivary gland. Expressed at low level in pituitary gland, apex of the heart, adult lung, prostate and mammary gland. Weakly or not expressed in hear
Sequence 
MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKY
LRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQA
LSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRS
FLQEFCKKYGGVSHHQSHLFHTVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASS
AYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSY
YHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHWEKVSKLCYPC
LINYDFVGKFETLEEDANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRT
ERQLIYDFYYLDYLMFNYTTPFL
Sequence length 443
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Various types of N-glycan biosynthesis
Metabolic pathways 		  Chondroitin sulfate biosynthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)		 23535729
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)		 25751625, 23535729, 29059683
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 30563176
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 30563176 ClinVar
Dental caries Dental caries GWAS
Bronchopulmonary Dysplasia Bronchopulmonary Dysplasia GWAS
Dyslexia Dyslexia GWAS
Show/Hide Text Mining Associations (7)
Associations from Text Mining
Disease Name Relationship Type References
Glioblastoma Associate 35456975
Glioma Associate 35456975
Lymphatic Metastasis Associate 28924212
Neoplasm Invasiveness Associate 28924212
Neoplasms Associate 25154973, 28924212
Triple Negative Breast Neoplasms Associate 28924212
Uveal melanoma Associate 40550052