CHST9 (carbohydrate sulfotransferase 9)

Gene

• Entrez ID: 83539
• Gene name: Carbohydrate sulfotransferase 9
• Gene symbol: CHST9
• Synonyms (NCBI Gene): GALNAC4ST-2, GalNAc4ST2
• Chromosome: 18
• Chromosome location: 18q11.2
• Summary: The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans.

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018484	hsa-miR-335-5p	Microarray	18185580
MIRT048939	hsa-miR-92a-3p	CLASH	23622248
MIRT892638	hsa-miR-323-3p	CLIP-seq
MIRT892639	hsa-miR-3545-3p	CLIP-seq
MIRT892640	hsa-miR-365	CLIP-seq
MIRT892641	hsa-miR-3685	CLIP-seq
MIRT892642	hsa-miR-384	CLIP-seq
MIRT892643	hsa-miR-4297	CLIP-seq
MIRT892644	hsa-miR-4509	CLIP-seq
MIRT892645	hsa-miR-4744	CLIP-seq
MIRT892646	hsa-miR-501-5p	CLIP-seq
MIRT892647	hsa-miR-532-5p	CLIP-seq
MIRT892648	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IDA	11139592, 11445554
GO:0001537	Function	Dermatan 4-sulfotransferase activity	IEA
GO:0001537	Function	Dermatan 4-sulfotransferase activity	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006790	Process	Sulfur compound metabolic process	IDA	11445554
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11139592
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IBA
GO:0030166	Process	Proteoglycan biosynthetic process	ISS
GO:0030203	Process	Glycosaminoglycan metabolic process	NAS	11139592
GO:0042446	Process	Hormone biosynthetic process	ISS
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	TAS
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	TAS

Other IDs

• MIM: 610191
• HGNC: 19898
• e!Ensembl: ENSG00000154080

Protein

• UniProt ID: Q7L1S5
• Protein name: Carbohydrate sulfotransferase 9 (EC 2.8.2.-) (GalNAc-4-O-sulfotransferase 2) (GalNAc-4-ST2) (GalNAc4ST-2) (N-acetylgalactosamine-4-O-sulfotransferase 2)
• Protein function: Catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans. Participates in biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulfation of th
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03567	Sulfotransfer_2	204 → 439	Sulfotransferase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in trachea. Also expressed in fetal lung, adult pancreas, testis and salivary gland. Expressed at low level in pituitary gland, apex of the heart, adult lung, prostate and mammary gland. Weakly or not expressed in hear
• Sequence:

  MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKY
  LRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQA
  LSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRS
  FLQEFCKKYGGVSHHQSHLFHTVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLASS
  AYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSY
  YHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHWEKVSKLCYPC
  LINYDFVGKFETLEEDANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRT
  ERQLIYDFYYLDYLMFNYTTPFL

• Sequence length: 443

Pathways

KEGG:

Various types of N-glycan biosynthesis
Metabolic pathways

Reactome:

Chondroitin sulfate biosynthesis