Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	83463
Gene name Gene Name - the full gene name approved by the HGNC.	MAX dimerization protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MXD3
Synonyms (NCBI Gene) Gene synonyms aliases	BHLHC13, MAD3, MYX
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators. The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promoters of target genes and

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050655	hsa-miR-18a-5p	CLASH	23622248
MIRT1166989	hsa-miR-135a	CLIP-seq
MIRT1166990	hsa-miR-135b	CLIP-seq
MIRT1166991	hsa-miR-548ad	CLIP-seq
MIRT1166992	hsa-miR-578	CLIP-seq
MIRT1166993	hsa-miR-1183	CLIP-seq
MIRT1166994	hsa-miR-1205	CLIP-seq
MIRT1166995	hsa-miR-1207-5p	CLIP-seq
MIRT1166996	hsa-miR-1294	CLIP-seq
MIRT1166997	hsa-miR-146b-3p	CLIP-seq
MIRT1166998	hsa-miR-1827	CLIP-seq
MIRT1166999	hsa-miR-1909	CLIP-seq
MIRT1167000	hsa-miR-200b	CLIP-seq
MIRT1167001	hsa-miR-200c	CLIP-seq
MIRT1167002	hsa-miR-22	CLIP-seq
MIRT1167003	hsa-miR-3119	CLIP-seq
MIRT1167004	hsa-miR-3173-5p	CLIP-seq
MIRT1167005	hsa-miR-3188	CLIP-seq
MIRT1167006	hsa-miR-3647-3p	CLIP-seq
MIRT1167007	hsa-miR-3714	CLIP-seq
MIRT1167008	hsa-miR-429	CLIP-seq
MIRT1167009	hsa-miR-4312	CLIP-seq
MIRT1167010	hsa-miR-4316	CLIP-seq
MIRT1167011	hsa-miR-4501	CLIP-seq
MIRT1167012	hsa-miR-4763-3p	CLIP-seq
MIRT1167013	hsa-miR-4763-5p	CLIP-seq
MIRT1167014	hsa-miR-548an	CLIP-seq
MIRT1167015	hsa-miR-582-5p	CLIP-seq
MIRT1167016	hsa-miR-874	CLIP-seq
MIRT1167017	hsa-miR-940	CLIP-seq
MIRT1166999	hsa-miR-1909	CLIP-seq
MIRT2048229	hsa-miR-2110	CLIP-seq
MIRT2048230	hsa-miR-3150a-3p	CLIP-seq
MIRT2048231	hsa-miR-3175	CLIP-seq
MIRT2048232	hsa-miR-4722-3p	CLIP-seq
MIRT1167013	hsa-miR-4763-5p	CLIP-seq
MIRT2048233	hsa-miR-939	CLIP-seq
MIRT2277100	hsa-miR-4289	CLIP-seq
MIRT1166991	hsa-miR-548ad	CLIP-seq
MIRT2277101	hsa-miR-548p	CLIP-seq
MIRT2277102	hsa-miR-653	CLIP-seq
MIRT2391205	hsa-miR-4493	CLIP-seq
MIRT2391206	hsa-miR-615-3p	CLIP-seq
MIRT2685580	hsa-miR-140-3p	CLIP-seq
MIRT2685581	hsa-miR-3065-3p	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA

MIM	HGNC	e!Ensembl
609450	14008	ENSG00000213347

Protein

UniProt ID

Q9BW11

Protein name

Max dimerization protein 3 (Max dimerizer 3) (Class C basic helix-loop-helix protein 13) (bHLHc13) (Max-associated protein 3) (Max-interacting transcriptional repressor MAD3) (Myx)

Protein function

Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	58 → 110	Helix-loop-helix DNA-binding domain	Domain

Sequence

MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRS
VHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLK
ERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVF
GGEAELLRGFVAGQEHSYSHGGGAWL

Sequence length

206

Interactions

View interactions

MXD3 (MAX dimerization protein 3)