Gene Gene information from NCBI Gene database.
Entrez ID 83461
Gene name Cell division cycle associated 3
Gene symbol CDCA3
Synonyms (NCBI Gene)
GRCC8TOME-1TOME1
Chromosome 12
Chromosome location 12p13.31
miRNA miRNA information provided by mirtarbase database.
125
miRTarBase ID miRNA Experiments Reference
MIRT029492 hsa-miR-26b-5p Microarray 19088304
MIRT051450 hsa-let-7e-5p CLASH 23622248
MIRT044752 hsa-miR-320a CLASH 23622248
MIRT451819 hsa-miR-3936 PAR-CLIP 23446348
MIRT451818 hsa-miR-3154 PAR-CLIP 23446348
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 27880917, 28514442, 31515488, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
GO:0005912 Component Adherens junction IDA 25468996
GO:0016567 Process Protein ubiquitination IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607749 14624 ENSG00000111665
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99618
Protein name Cell division cycle-associated protein 3 (Gene-rich cluster protein C8) (Trigger of mitotic entry protein 1) (TOME-1)
Protein function F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase (By similarity).
Family and domains
Sequence
MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKH
AQDSDPRSPTLGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSS
ELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRS
SGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTG
RLLKTGGRAWEQGQDHDKENQHFPLVES
Sequence length 268
Interactions View interactions