CDCA3 (cell division cycle associated 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83461
Gene name Gene Name - the full gene name approved by the HGNC.
Cell division cycle associated 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDCA3
Synonyms (NCBI Gene) Gene synonyms aliases
GRCC8, TOME-1, TOME1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(125)
miRTarBase ID miRNA Experiments Reference
MIRT029492 hsa-miR-26b-5p Microarray 19088304
MIRT051450 hsa-let-7e-5p CLASH 23622248
MIRT044752 hsa-miR-320a CLASH 23622248
MIRT451819 hsa-miR-3936 PAR-CLIP 23446348
MIRT451818 hsa-miR-3154 PAR-CLIP 23446348
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25416956, 27880917, 28514442, 31515488, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IEA
GO:0005912 Component Adherens junction IDA 25468996
GO:0016567 Process Protein ubiquitination IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607749 14624 ENSG00000111665
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q99618
Protein name Cell division cycle-associated protein 3 (Gene-rich cluster protein C8) (Trigger of mitotic entry protein 1) (TOME-1)
Protein function F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase (By similarity).
Family and domains
Sequence 
MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKH
AQDSDPRSPTLGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSS
ELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRS
SGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTG
RLLKTGGRAWEQGQDHDKENQHFPLVES
Sequence length 268
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myopia Myopia N/A N/A GWAS
Show/Hide Text Mining Associations (16)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 38216925
Carcinogenesis Associate 22839099, 25236463, 33604380
Carcinoma Hepatocellular Associate 25236463, 33604380
Carcinoma Non Small Cell Lung Associate 34050247
Carcinoma Renal Cell Associate 34699322, 34905505, 36404389
Hereditary Breast and Ovarian Cancer Syndrome Associate 25236463
Mouth Neoplasms Associate 22839099
Neoplasms Stimulate 22839099, 34970697
Neoplasms Associate 25236463, 28423514, 32716971, 33437202, 33604380, 34082692, 36081320, 37833711
Ovarian Neoplasms Associate 34577856, 36081320