Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8315
Gene name Gene Name - the full gene name approved by the HGNC.
BRCA1 associated protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BRAP
Synonyms (NCBI Gene) Gene synonyms aliases
BRAP2, IMP, RNF52
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signa
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003364 hsa-miR-221-3p Reporter assay;Microarray 20018759
MIRT036070 hsa-miR-1296-5p CLASH 23622248
MIRT716586 hsa-miR-4318 HITS-CLIP 19536157
MIRT716585 hsa-miR-3614-5p HITS-CLIP 19536157
MIRT716584 hsa-miR-6500-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IDA 14724641
GO:0000165 Process MAPK cascade IDA 14724641
GO:0000165 Process MAPK cascade TAS
GO:0003676 Function Nucleic acid binding IEA
GO:0004842 Function Ubiquitin-protein transferase activity IDA 14724641
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604986 1099 ENSG00000089234
Protein
UniProt ID Q7Z569
Protein name BRCA1-associated protein (EC 2.3.2.27) (BRAP2) (Impedes mitogenic signal propagation) (IMP) (RING finger protein 52) (RING-type E3 ubiquitin transferase BRAP2) (Renal carcinoma antigen NY-REN-63)
Protein function Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-po
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07576 BRAP2 154 252 BRCA1-associated protein 2 Family
PF13639 zf-RING_2 262 304 Ring finger domain Domain
PF02148 zf-UBP 317 379 Zn-finger in ubiquitin-hydrolases and other protein Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in breast epithelial cell lines. {ECO:0000269|PubMed:9497340}.
Sequence
MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAII
HQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSK
QLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKF
VAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVE
RAEVLKSEDGAS
LPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTC
PVCR
YCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQL
TNHRVWDYAGDNYVHRLVA
SKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQR
IYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKV
AKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYL
ETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK
Sequence length 592
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ras signaling pathway   RAF activation
Negative regulation of MAPK pathway
Signaling by moderate kinase activity BRAF mutants
Paradoxical activation of RAF signaling by kinase inactive BRAF
Signaling downstream of RAS mutants
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Epilepsy Epilepsy N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abetalipoproteinemia Associate 29165153
Alzheimer Disease Associate 32205467
Atherosclerosis Associate 23356535, 24916648
Breast Neoplasms Inhibit 33514303
Carcinoma Non Small Cell Lung Associate 33529461
Carcinoma Renal Cell Associate 33529461
Cardiovascular Diseases Associate 22965072
Carotid Artery Diseases Associate 21301165
Carotid Artery Diseases Stimulate 33514303
Cholangiocarcinoma Associate 33529461