Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8313
Gene name Gene Name - the full gene name approved by the HGNC.	Axin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AXIN2
Synonyms (NCBI Gene) Gene synonyms aliases	AXIL, ODCRCS
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q24.1
Summary Summary of gene provided in NCBI Entrez Gene.	The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex o

Show/Hide all(45)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121908567	C>A,T	Pathogenic	Coding sequence variant, missense variant, stop gained
rs121908568	G>A	Pathogenic	Coding sequence variant, stop gained
rs138287857	G>A	Likely-pathogenic, likely-benign, benign-likely-benign	Coding sequence variant, missense variant
rs139316692	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, benign	Coding sequence variant, synonymous variant
rs139871607	T>C	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Coding sequence variant, missense variant
rs140344858	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant
rs140510381	C>A,T	Conflicting-interpretations-of-pathogenicity, benign, uncertain-significance	Coding sequence variant, missense variant
rs141655687	G>A,C	Conflicting-interpretations-of-pathogenicity, likely-benign, benign, uncertain-significance	Coding sequence variant, synonymous variant, missense variant
rs142476324	A>G	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant
rs142670753	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Coding sequence variant, missense variant
rs143571197	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs145007501	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign, benign-likely-benign	Coding sequence variant, missense variant
rs145717795	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Coding sequence variant, missense variant
rs148765149	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs149764887	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs200201811	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant, missense variant, coding sequence variant
rs201531372	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant
rs267606674	C>-,CC	Likely-pathogenic, pathogenic	Frameshift variant, coding sequence variant
rs367624903	C>A,T	Pathogenic, uncertain-significance	Stop gained, coding sequence variant, missense variant
rs376052287	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs570443161	GGTGGTGGT>-,GGTGGT,GGTGGTGGTGGT,GGTGGTGGTGGTGGT	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Coding sequence variant, inframe insertion, inframe deletion
rs730882193	C>G,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant, stop gained
rs748632114	C>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs752881223	A>C,G	Pathogenic	Coding sequence variant, missense variant
rs762279806	G>A,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs771001164	CTCT>-,CT	Pathogenic	Frameshift variant, coding sequence variant
rs772461187	G>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs773157765	C>T	Likely-pathogenic	Splice acceptor variant
rs775783026	T>C	Likely-pathogenic	Splice acceptor variant
rs978837790	T>C	Likely-pathogenic	Splice acceptor variant
rs1056103847	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1299440644	A>-	Likely-pathogenic, pathogenic	Coding sequence variant, frameshift variant
rs1309148182	C>T	Likely-pathogenic	Splice acceptor variant, intron variant
rs1555577613	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555577625	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555583659	CG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1567754914	G>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1567755946	->CGCGGGAGGCAGC	Pathogenic	Frameshift variant, coding sequence variant
rs1567769335	C>T	Pathogenic	Stop gained, coding sequence variant
rs1598093952	AAGT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1598097196	G>A	Pathogenic	Coding sequence variant, stop gained
rs1598104209	G>A	Pathogenic	Coding sequence variant, stop gained
rs1598118962	AG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1598119841	G>A	Pathogenic	Coding sequence variant, stop gained
rs1598119889	C>T	Pathogenic	Coding sequence variant, stop gained

Show/Hide all(374)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001232	hsa-miR-34a-5p	Luciferase reporter assay	19336450
MIRT001232	hsa-miR-34a-5p	Luciferase reporter assay	19336450
MIRT001232	hsa-miR-34a-5p	Luciferase reporter assay	19336450
MIRT001232	hsa-miR-34a-5p	Luciferase reporter assay	19336450
MIRT006750	hsa-miR-15b-5p	Luciferase reporter assay	21501592
MIRT006750	hsa-miR-15b-5p	Luciferase reporter assay	21501592
MIRT006750	hsa-miR-15b-5p	Luciferase reporter assay	21501592
MIRT006751	hsa-miR-16-5p	Luciferase reporter assay	21501592
MIRT006751	hsa-miR-16-5p	Luciferase reporter assay	21501592
MIRT006751	hsa-miR-16-5p	Luciferase reporter assay	21501592
MIRT006752	hsa-miR-107	Luciferase reporter assay	21501592
MIRT006752	hsa-miR-107	Luciferase reporter assay	21501592
MIRT006752	hsa-miR-107	Luciferase reporter assay	21501592
MIRT027137	hsa-miR-103a-3p	Sequencing	20371350
MIRT006751	hsa-miR-16-5p	Sequencing	20371350
MIRT054054	hsa-miR-34a-3p	Luciferase reporter assay, Western blot	22421157
MIRT054054	hsa-miR-34a-3p	Luciferase reporter assay, Western blot	22421157
MIRT054055	hsa-miR-34b-5p	Luciferase reporter assay, Western blot	22421157
MIRT054055	hsa-miR-34b-5p	Luciferase reporter assay, Western blot	22421157
MIRT054056	hsa-miR-34c-3p	Luciferase reporter assay, Western blot	22421157
MIRT054056	hsa-miR-34c-3p	Luciferase reporter assay, Western blot	22421157
MIRT006752	hsa-miR-107	HITS-CLIP	21572407
MIRT027137	hsa-miR-103a-3p	HITS-CLIP	21572407
MIRT508036	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT508041	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT006750	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT006751	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT508038	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT508039	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT508040	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT508037	hsa-miR-2278	HITS-CLIP	21572407
MIRT508035	hsa-miR-4496	HITS-CLIP	21572407
MIRT508034	hsa-miR-6501-3p	HITS-CLIP	21572407
MIRT508033	hsa-miR-3148	HITS-CLIP	21572407
MIRT508032	hsa-miR-4668-5p	HITS-CLIP	21572407
MIRT006752	hsa-miR-107	PAR-CLIP	20371350
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT508036	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT006751	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT508038	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT508039	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT508037	hsa-miR-2278	PAR-CLIP	20371350
MIRT508035	hsa-miR-4496	PAR-CLIP	20371350
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT508033	hsa-miR-3148	PAR-CLIP	20371350
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT006752	hsa-miR-107	PAR-CLIP	20371350
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT508036	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT006751	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT508038	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT508039	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT508037	hsa-miR-2278	PAR-CLIP	20371350
MIRT508035	hsa-miR-4496	PAR-CLIP	20371350
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT508033	hsa-miR-3148	PAR-CLIP	20371350
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT006752	hsa-miR-107	PAR-CLIP	20371350
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT508036	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT006751	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT508038	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT508039	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT508037	hsa-miR-2278	PAR-CLIP	20371350
MIRT508035	hsa-miR-4496	PAR-CLIP	20371350
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT508033	hsa-miR-3148	PAR-CLIP	20371350
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT006752	hsa-miR-107	PAR-CLIP	20371350
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT508036	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT006751	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT508038	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT508039	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT508037	hsa-miR-2278	PAR-CLIP	20371350
MIRT508035	hsa-miR-4496	PAR-CLIP	20371350
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT508033	hsa-miR-3148	PAR-CLIP	20371350
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT006752	hsa-miR-107	PAR-CLIP	21572407
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT508039	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT006751	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT508038	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT508036	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT549236	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT549235	hsa-miR-641	PAR-CLIP	21572407
MIRT508037	hsa-miR-2278	PAR-CLIP	21572407
MIRT508035	hsa-miR-4496	PAR-CLIP	21572407
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT508033	hsa-miR-3148	PAR-CLIP	21572407
MIRT549234	hsa-miR-208a-3p	PAR-CLIP	21572407
MIRT549233	hsa-miR-208b-3p	PAR-CLIP	21572407
MIRT549232	hsa-miR-499a-5p	PAR-CLIP	21572407
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT006752	hsa-miR-107	PAR-CLIP	21572407
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT508036	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT006751	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT508038	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT508039	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT549236	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT549235	hsa-miR-641	PAR-CLIP	21572407
MIRT508037	hsa-miR-2278	PAR-CLIP	21572407
MIRT508035	hsa-miR-4496	PAR-CLIP	21572407
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT508033	hsa-miR-3148	PAR-CLIP	21572407
MIRT549234	hsa-miR-208a-3p	PAR-CLIP	21572407
MIRT549233	hsa-miR-208b-3p	PAR-CLIP	21572407
MIRT549232	hsa-miR-499a-5p	PAR-CLIP	21572407
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT006752	hsa-miR-107	PAR-CLIP	23446348
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT508036	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT006751	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT508038	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT508039	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT508037	hsa-miR-2278	PAR-CLIP	23446348
MIRT508035	hsa-miR-4496	PAR-CLIP	23446348
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	23446348
MIRT508033	hsa-miR-3148	PAR-CLIP	23446348
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT006752	hsa-miR-107	PAR-CLIP	23446348
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT508039	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT006751	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT508038	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT508036	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT508037	hsa-miR-2278	PAR-CLIP	23446348
MIRT508035	hsa-miR-4496	PAR-CLIP	23446348
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	23446348
MIRT508033	hsa-miR-3148	PAR-CLIP	23446348
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT732825	hsa-miR-1246	Immunofluorescence, Luciferase reporter assay, qRT-PCR	27639189
MIRT006751	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33920233
MIRT735180	hsa-miR-206	Immunohistochemistry (IHC), qRT-PCR, In situ hybridization	32722078
MIRT027137	hsa-miR-103a-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR, Flow cytometry	31650542
MIRT006752	hsa-miR-107	HITS-CLIP	21572407
MIRT027137	hsa-miR-103a-3p	HITS-CLIP	21572407
MIRT508036	hsa-miR-424-5p	HITS-CLIP	21572407
MIRT508041	hsa-miR-15a-5p	HITS-CLIP	21572407
MIRT006750	hsa-miR-15b-5p	HITS-CLIP	21572407
MIRT006751	hsa-miR-16-5p	HITS-CLIP	21572407
MIRT508038	hsa-miR-195-5p	HITS-CLIP	21572407
MIRT508039	hsa-miR-497-5p	HITS-CLIP	21572407
MIRT508040	hsa-miR-6838-5p	HITS-CLIP	21572407
MIRT508037	hsa-miR-2278	HITS-CLIP	21572407
MIRT508035	hsa-miR-4496	HITS-CLIP	21572407
MIRT508034	hsa-miR-6501-3p	HITS-CLIP	21572407
MIRT508033	hsa-miR-3148	HITS-CLIP	21572407
MIRT508032	hsa-miR-4668-5p	HITS-CLIP	21572407
MIRT006752	hsa-miR-107	PAR-CLIP	20371350
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT508036	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT006751	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT508038	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT508039	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT508037	hsa-miR-2278	PAR-CLIP	20371350
MIRT508035	hsa-miR-4496	PAR-CLIP	20371350
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT508033	hsa-miR-3148	PAR-CLIP	20371350
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT006752	hsa-miR-107	PAR-CLIP	20371350
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT508036	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT006751	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT508038	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT508039	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT508037	hsa-miR-2278	PAR-CLIP	20371350
MIRT508035	hsa-miR-4496	PAR-CLIP	20371350
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT508033	hsa-miR-3148	PAR-CLIP	20371350
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT006752	hsa-miR-107	PAR-CLIP	20371350
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT508036	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT006751	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT508038	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT508039	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT508037	hsa-miR-2278	PAR-CLIP	20371350
MIRT508035	hsa-miR-4496	PAR-CLIP	20371350
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT508033	hsa-miR-3148	PAR-CLIP	20371350
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT006752	hsa-miR-107	PAR-CLIP	20371350
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT508036	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT006751	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT508038	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT508039	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT508037	hsa-miR-2278	PAR-CLIP	20371350
MIRT508035	hsa-miR-4496	PAR-CLIP	20371350
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	20371350
MIRT508033	hsa-miR-3148	PAR-CLIP	20371350
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT006752	hsa-miR-107	PAR-CLIP	21572407
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT508039	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT006751	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT508038	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT508036	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT549236	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT549235	hsa-miR-641	PAR-CLIP	21572407
MIRT508037	hsa-miR-2278	PAR-CLIP	21572407
MIRT508035	hsa-miR-4496	PAR-CLIP	21572407
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT508033	hsa-miR-3148	PAR-CLIP	21572407
MIRT549234	hsa-miR-208a-3p	PAR-CLIP	21572407
MIRT549233	hsa-miR-208b-3p	PAR-CLIP	21572407
MIRT549232	hsa-miR-499a-5p	PAR-CLIP	21572407
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT006752	hsa-miR-107	PAR-CLIP	21572407
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT508036	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT006751	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT508038	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT508039	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT549236	hsa-miR-3617-5p	PAR-CLIP	21572407
MIRT549235	hsa-miR-641	PAR-CLIP	21572407
MIRT508037	hsa-miR-2278	PAR-CLIP	21572407
MIRT508035	hsa-miR-4496	PAR-CLIP	21572407
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	21572407
MIRT508033	hsa-miR-3148	PAR-CLIP	21572407
MIRT549234	hsa-miR-208a-3p	PAR-CLIP	21572407
MIRT549233	hsa-miR-208b-3p	PAR-CLIP	21572407
MIRT549232	hsa-miR-499a-5p	PAR-CLIP	21572407
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT006752	hsa-miR-107	PAR-CLIP	23446348
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT508036	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT006751	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT508038	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT508039	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT508037	hsa-miR-2278	PAR-CLIP	23446348
MIRT508035	hsa-miR-4496	PAR-CLIP	23446348
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	23446348
MIRT508033	hsa-miR-3148	PAR-CLIP	23446348
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT006752	hsa-miR-107	PAR-CLIP	23446348
MIRT027137	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT508041	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT508040	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT508039	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT006751	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT006750	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT508038	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT508036	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT508037	hsa-miR-2278	PAR-CLIP	23446348
MIRT508035	hsa-miR-4496	PAR-CLIP	23446348
MIRT508034	hsa-miR-6501-3p	PAR-CLIP	23446348
MIRT508033	hsa-miR-3148	PAR-CLIP	23446348
MIRT508032	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT732825	hsa-miR-1246	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, RNA-seq	35216222
MIRT812386	hsa-miR-103a	CLIP-seq
MIRT812387	hsa-miR-1275	CLIP-seq
MIRT812388	hsa-miR-130a	CLIP-seq
MIRT812389	hsa-miR-130b	CLIP-seq
MIRT812390	hsa-miR-15a	CLIP-seq
MIRT812391	hsa-miR-15b	CLIP-seq
MIRT812392	hsa-miR-16	CLIP-seq
MIRT812393	hsa-miR-183	CLIP-seq
MIRT812394	hsa-miR-193a-3p	CLIP-seq
MIRT812395	hsa-miR-193b	CLIP-seq
MIRT812396	hsa-miR-195	CLIP-seq
MIRT812397	hsa-miR-19a	CLIP-seq
MIRT812398	hsa-miR-19b	CLIP-seq
MIRT812399	hsa-miR-221	CLIP-seq
MIRT812400	hsa-miR-222	CLIP-seq
MIRT812401	hsa-miR-2276	CLIP-seq
MIRT812402	hsa-miR-2861	CLIP-seq
MIRT812403	hsa-miR-301a	CLIP-seq
MIRT812404	hsa-miR-301b	CLIP-seq
MIRT812405	hsa-miR-3127-3p	CLIP-seq
MIRT812406	hsa-miR-3150a-3p	CLIP-seq
MIRT812407	hsa-miR-3175	CLIP-seq
MIRT812408	hsa-miR-3184	CLIP-seq
MIRT812409	hsa-miR-330-3p	CLIP-seq
MIRT812410	hsa-miR-34a	CLIP-seq
MIRT812411	hsa-miR-34c-5p	CLIP-seq
MIRT812412	hsa-miR-3666	CLIP-seq
MIRT812413	hsa-miR-3691-3p	CLIP-seq
MIRT812414	hsa-miR-3924	CLIP-seq
MIRT812415	hsa-miR-3942-3p	CLIP-seq
MIRT812416	hsa-miR-3975	CLIP-seq
MIRT812417	hsa-miR-423-5p	CLIP-seq
MIRT812418	hsa-miR-424	CLIP-seq
MIRT812419	hsa-miR-4290	CLIP-seq
MIRT812420	hsa-miR-4295	CLIP-seq
MIRT812421	hsa-miR-4421	CLIP-seq
MIRT812422	hsa-miR-4422	CLIP-seq
MIRT812423	hsa-miR-4450	CLIP-seq
MIRT812424	hsa-miR-4476	CLIP-seq
MIRT812425	hsa-miR-4493	CLIP-seq
MIRT812426	hsa-miR-4495	CLIP-seq
MIRT812427	hsa-miR-449a	CLIP-seq
MIRT812428	hsa-miR-449b	CLIP-seq
MIRT812429	hsa-miR-4525	CLIP-seq
MIRT812430	hsa-miR-454	CLIP-seq
MIRT812431	hsa-miR-4665-5p	CLIP-seq
MIRT812432	hsa-miR-4667-5p	CLIP-seq
MIRT812433	hsa-miR-4671-3p	CLIP-seq
MIRT812434	hsa-miR-4700-5p	CLIP-seq
MIRT812435	hsa-miR-4716-3p	CLIP-seq
MIRT812436	hsa-miR-4723-5p	CLIP-seq
MIRT812437	hsa-miR-4772-3p	CLIP-seq
MIRT812438	hsa-miR-4789-5p	CLIP-seq
MIRT812439	hsa-miR-497	CLIP-seq
MIRT812440	hsa-miR-518a-5p	CLIP-seq
MIRT812441	hsa-miR-527	CLIP-seq
MIRT812442	hsa-miR-548a-3p	CLIP-seq
MIRT812443	hsa-miR-548e	CLIP-seq
MIRT812444	hsa-miR-548f	CLIP-seq
MIRT812445	hsa-miR-625	CLIP-seq
MIRT812446	hsa-miR-656	CLIP-seq
MIRT812447	hsa-miR-661	CLIP-seq
MIRT812448	hsa-miR-939	CLIP-seq
MIRT1940255	hsa-miR-4704-3p	CLIP-seq
MIRT1940256	hsa-miR-4714-3p	CLIP-seq
MIRT1940257	hsa-miR-490-3p	CLIP-seq
MIRT1940258	hsa-miR-513a-5p	CLIP-seq
MIRT812386	hsa-miR-103a	CLIP-seq
MIRT812422	hsa-miR-4422	CLIP-seq
MIRT812399	hsa-miR-221	CLIP-seq
MIRT812400	hsa-miR-222	CLIP-seq
MIRT2444527	hsa-miR-3163	CLIP-seq
MIRT2444528	hsa-miR-4282	CLIP-seq
MIRT2444529	hsa-miR-4484	CLIP-seq
MIRT2444530	hsa-miR-548an	CLIP-seq
MIRT2444531	hsa-miR-590-3p	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
CDX2	Activation	23393221
CDX2	Unknown	24501326
MYC	Unknown	24299953
SOX4	Unknown	22098624

Show/Hide all(69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001957	Process	Intramembranous ossification	IEA
GO:0003139	Process	Secondary heart field specification	IEA
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003183	Process	Mitral valve morphogenesis	IEA
GO:0003183	Process	Mitral valve morphogenesis	ISS
GO:0003413	Process	Chondrocyte differentiation involved in endochondral bone morphogenesis	IEA
GO:0005515	Function	Protein binding	IPI	10698523, 16815967, 17510365, 22056988, 23455922, 23602568, 24251807, 25873176, 29568061, 30824926, 32296183, 32707033, 33961781, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12072559, 21383061
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	21383061
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	20300119
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0008013	Function	Beta-catenin binding	IBA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008013	Function	Beta-catenin binding	NAS	11017067
GO:0008104	Process	Intracellular protein localization	IDA	17072303
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009950	Process	Dorsal/ventral axis specification	IEA
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	17072303
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0019899	Function	Enzyme binding	IPI	19759537, 21383061, 21478859
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030282	Process	Bone mineralization	IEA
GO:0030877	Component	Beta-catenin destruction complex	IBA
GO:0030877	Component	Beta-catenin destruction complex	NAS	9601641, 11017067
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21478859
GO:0032423	Process	Regulation of mismatch repair	IMP	11017067
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033687	Process	Osteoblast proliferation	IEA
GO:0033689	Process	Negative regulation of osteoblast proliferation	IEA
GO:0042476	Process	Odontogenesis	IMP	15042511, 16432638
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	9601641
GO:0043570	Process	Maintenance of DNA repeat elements	IMP	18755497
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0048255	Process	MRNA stabilization	IMP	17072303
GO:0048468	Process	Cell development	IBA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	17072303, 20300119
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0061181	Process	Regulation of chondrocyte development	IEA
GO:0070411	Function	I-SMAD binding	IBA
GO:0070411	Function	I-SMAD binding	IEA
GO:0070602	Process	Regulation of centromeric sister chromatid cohesion	IBA
GO:0070602	Process	Regulation of centromeric sister chromatid cohesion	IEA
GO:0070602	Process	Regulation of centromeric sister chromatid cohesion	IMP	20300119
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	11940574
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	11017067, 16247484
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:1903053	Process	Regulation of extracellular matrix organization	IEA
GO:1903053	Process	Regulation of extracellular matrix organization	ISS

MIM	HGNC	e!Ensembl
604025	904	ENSG00000168646

Protein

UniProt ID

Q9Y2T1

Protein name

Axin-2 (Axin-like protein) (Axil) (Axis inhibition protein 2) (Conductin)

Protein function

Inhibitor of the Wnt signaling pathway. Down-regulates beta-catenin. Probably facilitate the phosphorylation of beta-catenin and APC by GSK3B.

PDB

8HEO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16646	AXIN1_TNKS_BD	9 → 73	Axin-1 tankyrase binding domain	Disordered
PF00615	RGS	81 → 199	Regulator of G protein signaling domain	Domain
PF08833	Axin_b-cat_bind	433 → 469	Axin beta-catenin binding motif	Motif
PF00778	DIX	762 → 841	DIX domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and lymphoblast.

Sequence

MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LPPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGSEYYCYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID

Sequence length

843

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Colorectal cancer Endometrial cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		TCF dependent signaling in response to WNT Binding of TCF/LEF:CTNNB1 to target gene promoters Degradation of AXIN Ub-specific processing proteases

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Adenomatous Polyposis	axin2-related attenuated familial adenomatous polyposis	rs730882193	N/A
colorectal cancer	Colorectal cancer	rs2043913790, rs267606674	N/A
Oligodontia-Cancer Predisposition Syndrome	oligodontia-cancer predisposition syndrome	rs1567755946, rs2043947540, rs730882193, rs1598093952, rs552141978, rs1555577625, rs1598097196, rs2044303218, rs1555583659, rs1598104209, rs2044308192, rs1555577613, rs1598118962, rs2043981878, rs367624903 View all (10 more)	N/A

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Malignant tumor of breast	N/A	N/A	ClinVar
Craniosynostosis	craniosynostosis	N/A	N/A	GenCC
craniosynostosis syndrome	Craniosynostosis syndrome	N/A	N/A	ClinVar
hereditary cancer	Hereditary cancer	N/A	N/A	ClinVar
ovarian cancer	Ovarian cancer	N/A	N/A	ClinVar
Tooth Agenesis	tooth agenesis	N/A	N/A	GenCC

Show/Hide Text Mining Associations (98)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Stimulate	26297437
Adenocarcinoma Mucinous	Inhibit	18422752
Adenoma	Associate	24964857, 27245242, 32258125, 32807118
Adenomatous Polyposis Coli	Associate	11752446, 21416598, 23838596, 27482906, 32807118, 36502525
Adenomatous Polyposis Coli	Inhibit	11940574, 18708403
Adenomatous Polyposis Coli	Stimulate	30072583
Adrenocortical Carcinoma	Associate	29872083
Anemia Hemolytic	Associate	30942098
Angiofibroma	Associate	26572152
Anodontia	Associate	15042511, 18683894, 18790474, 23227268, 24160254, 24631698, 29893310, 31781599, 31914153, 32807118, 36017684, 36502525, 36860143, 38115305, 39183201
Anodontia of Permanent Dentition	Associate	32807118
Attenuated familial adenomatous polyposis	Associate	23838596, 31285513
Barrett Esophagus	Stimulate	26297437
Breast Neoplasms	Associate	18708403, 21416598, 23516639, 26514524, 27188720, 30442712, 34452579, 34454393, 35996498
Carcinogenesis	Associate	24631698, 26514524, 27188720
Carcinoma Basal Cell	Associate	27825128
Carcinoma Hepatocellular	Associate	23651211, 25119594, 26191213, 33811251
Carcinoma Non Small Cell Lung	Associate	24980784, 36005189, 37074454
Carcinoma Pancreatic Ductal	Associate	34454393
Central Nervous System Infections	Associate	27825128
Cholangiocarcinoma	Inhibit	37832404
Chromosomal Instability	Stimulate	16815967
Cleft Lip	Associate	18683894, 36860143
Cleft Palate	Associate	18683894, 19119171, 28376813, 29211286, 36860143
Colonic Neoplasms	Stimulate	11752446
Colonic Neoplasms	Associate	16815967, 22745173, 24299953, 24964857, 27245242, 28714374
Colonic Polyps	Associate	36860143
Colorectal Neoplasms	Associate	11752446, 15042511, 16815967, 18422752, 18683894, 18790474, 19119171, 20696052, 23624843, 23951239, 24299953, 24631698, 27245242, 27696107, 28534366 View all (15 more)
Colorectal Neoplasms	Inhibit	22745173
Colorectal Neoplasms	Stimulate	32258125
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	23951239
Conversion Disorder	Associate	36017684
Craniopharyngioma	Associate	18540944
Craniosynostoses	Associate	32575385
Deafness oligodontia syndrome	Associate	15042511, 18790474, 21416598, 24222224, 26406231, 35876356
Dysgeusia	Associate	35620969
Ectodermal Dysplasia	Associate	21416598, 23838596, 32807118
Ectodermal Dysplasia 1 Anhidrotic	Associate	26759063
Endometrial Neoplasms	Associate	38115305
Esophageal Squamous Cell Carcinoma	Associate	18084253
Esthesioneuroblastoma Olfactory	Associate	32807118
Familial Primary Pulmonary Hypertension	Associate	27188753
Gallbladder Neoplasms	Associate	26715268
Gastrointestinal Neoplasms	Associate	32807118
Glioblastoma	Associate	26222502
Glioma	Associate	26222502
Heart Defects Congenital	Associate	33096676
Hereditary pancreatitis	Associate	28376813
Heterotaxy visceral X linked	Associate	31781599
Hyperlipoproteinemia Type II	Associate	31563876
Hypoxia	Inhibit	25347326
Hypoxia	Associate	38035113
Inflammation	Associate	38170256
Inflammatory Bowel Diseases	Inhibit	33930428
Insulin Resistance	Associate	30678306
Jaw Edentulous	Associate	32184411
Leukemia Lymphocytic Chronic B Cell	Associate	35440565
Leukemia Myeloid Acute	Associate	25734857, 35780585
Leukoplakia	Associate	32184411
Lung Neoplasms	Associate	25091576, 28378643, 35101137
Lupus Nephritis	Stimulate	24465439
Lymphatic Metastasis	Associate	31723073
Malaria Cerebral	Inhibit	32801995
Melanoma	Associate	32933177
Microsatellite Instability	Associate	15802015, 20696052, 24964857, 31769227
Muscular Dystrophy Congenital Megaconial Type	Associate	36017684
Neoplasm Metastasis	Associate	26771938
Neoplasm Metastasis	Stimulate	27825128
Neoplasms	Stimulate	11940574, 18540944, 22745173, 27825128, 32258125
Neoplasms	Inhibit	11940574, 15611123, 16815967, 18708403, 28378643, 29716922, 33941878, 35216222
Neoplasms	Associate	15042511, 18683894, 18790474, 22699938, 23651211, 24964857, 25091576, 25119594, 26771938, 27009842, 28376813, 29872083, 30255827, 30942098, 31534175 View all (12 more)
Neuroblastoma	Associate	27009842
Oligodontia Colorectal Cancer Syndrome	Associate	36860143
Orofacial Cleft 1	Associate	32710482
Osteosarcoma	Associate	26617789
Ovarian Neoplasms	Associate	20635389, 24078348
Ovarian Neoplasms	Stimulate	21666490
Overbite	Associate	18790474
Pain	Associate	36042639
Pancreatic Neoplasms	Associate	37488774, 38035113
Paraganglioma	Associate	34454393
Polycystic Ovary Syndrome	Associate	39912710
Polyposis Of Gastric Fundus Without Polyposis Coli	Associate	36042639
Polyps	Associate	21416598, 23838596
Prostatic Neoplasms	Stimulate	18478098
Prostatic Neoplasms	Associate	26771938
Pulmonary Arterial Hypertension	Associate	27188753
Retinal Dysplasia	Associate	24925057
Schilbach Rott Syndrome Ocular Hypotelorism Submucosal Cleft Palate and Hypospadias	Associate	24925057
Squamous Cell Carcinoma of Head and Neck	Associate	36007290
Stomach Diseases	Associate	18330950
Stomach Neoplasms	Associate	18330950, 18683894, 36551233, 36578802
Thyroid Cancer Papillary	Associate	34281460
Tooth Injuries	Associate	39183201
Tooth Loss	Associate	32184411
Triple Negative Breast Neoplasms	Associate	24188694
Urinary Bladder Neoplasms	Associate	30070321, 36331809
Uterine Cervical Neoplasms	Associate	34309414

AXIN2 (axin 2)