Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	831
Gene name Gene Name - the full gene name approved by the HGNC.	Calpastatin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CAST
Synonyms (NCBI Gene) Gene synonyms aliases	BS-17, MIR583HG, PLACK
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q15
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs786204842	A>T	Pathogenic	Coding sequence variant, genic upstream transcript variant, stop gained
rs786205140	->A	Pathogenic	Coding sequence variant, frameshift variant, genic upstream transcript variant

Show/Hide all(83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022430	hsa-miR-124-3p	Microarray	18668037
MIRT023661	hsa-miR-1-3p	Proteomics	18668040
MIRT028450	hsa-miR-30a-5p	Proteomics	18668040
MIRT046826	hsa-miR-222-3p	CLASH	23622248
MIRT437633	hsa-miR-150-5p	Microarray, qRT-PCR	22815788
MIRT864299	hsa-miR-129-5p	CLIP-seq
MIRT864300	hsa-miR-1912	CLIP-seq
MIRT864301	hsa-miR-19a	CLIP-seq
MIRT864302	hsa-miR-19b	CLIP-seq
MIRT864303	hsa-miR-3910	CLIP-seq
MIRT864304	hsa-miR-4269	CLIP-seq
MIRT864305	hsa-miR-4438	CLIP-seq
MIRT864306	hsa-miR-4476	CLIP-seq
MIRT864307	hsa-miR-4493	CLIP-seq
MIRT864308	hsa-miR-4521	CLIP-seq
MIRT864309	hsa-miR-4639-5p	CLIP-seq
MIRT864310	hsa-miR-4753-5p	CLIP-seq
MIRT864311	hsa-miR-4777-5p	CLIP-seq
MIRT864312	hsa-miR-5095	CLIP-seq
MIRT864313	hsa-miR-518d-5p	CLIP-seq
MIRT864314	hsa-miR-519b-5p	CLIP-seq
MIRT864315	hsa-miR-519c-5p	CLIP-seq
MIRT864316	hsa-miR-520c-5p	CLIP-seq
MIRT864317	hsa-miR-526a	CLIP-seq
MIRT864318	hsa-miR-759	CLIP-seq
MIRT864319	hsa-miR-892a	CLIP-seq
MIRT864320	hsa-miR-1275	CLIP-seq
MIRT864321	hsa-miR-4260	CLIP-seq
MIRT864322	hsa-miR-4665-5p	CLIP-seq
MIRT864323	hsa-miR-4723-5p	CLIP-seq
MIRT864324	hsa-miR-496	CLIP-seq
MIRT864325	hsa-miR-576-3p	CLIP-seq
MIRT1956185	hsa-miR-224	CLIP-seq
MIRT1956186	hsa-miR-340	CLIP-seq
MIRT1956187	hsa-miR-4307	CLIP-seq
MIRT1956188	hsa-miR-495	CLIP-seq
MIRT864301	hsa-miR-19a	CLIP-seq
MIRT864302	hsa-miR-19b	CLIP-seq
MIRT2436056	hsa-miR-1228	CLIP-seq
MIRT2436057	hsa-miR-2115	CLIP-seq
MIRT2436058	hsa-miR-3128	CLIP-seq
MIRT2436059	hsa-miR-3907	CLIP-seq
MIRT2436060	hsa-miR-3936	CLIP-seq
MIRT2436061	hsa-miR-4470	CLIP-seq
MIRT2436062	hsa-miR-516a-3p	CLIP-seq
MIRT2436056	hsa-miR-1228	CLIP-seq
MIRT2446211	hsa-miR-133a	CLIP-seq
MIRT2446212	hsa-miR-133b	CLIP-seq
MIRT2446213	hsa-miR-298	CLIP-seq
MIRT2436058	hsa-miR-3128	CLIP-seq
MIRT2446214	hsa-miR-342-3p	CLIP-seq
MIRT2446215	hsa-miR-3622a-3p	CLIP-seq
MIRT2446216	hsa-miR-3622b-3p	CLIP-seq
MIRT2446217	hsa-miR-3688-3p	CLIP-seq
MIRT2446218	hsa-miR-3914	CLIP-seq
MIRT2446219	hsa-miR-3915	CLIP-seq
MIRT2446220	hsa-miR-3928	CLIP-seq
MIRT2446221	hsa-miR-4328	CLIP-seq
MIRT2446222	hsa-miR-4802-3p	CLIP-seq
MIRT2446223	hsa-miR-494	CLIP-seq
MIRT2446224	hsa-miR-544b	CLIP-seq
MIRT2497090	hsa-miR-1245b-3p	CLIP-seq
MIRT864299	hsa-miR-129-5p	CLIP-seq
MIRT2497091	hsa-miR-1297	CLIP-seq
MIRT2497092	hsa-miR-1911	CLIP-seq
MIRT864301	hsa-miR-19a	CLIP-seq
MIRT864302	hsa-miR-19b	CLIP-seq
MIRT2497093	hsa-miR-26a	CLIP-seq
MIRT2497094	hsa-miR-26b	CLIP-seq
MIRT2497095	hsa-miR-3064-3p	CLIP-seq
MIRT2497096	hsa-miR-3653	CLIP-seq
MIRT2497097	hsa-miR-3658	CLIP-seq
MIRT2497098	hsa-miR-4465	CLIP-seq
MIRT2497099	hsa-miR-4694-5p	CLIP-seq
MIRT2497100	hsa-miR-4760-5p	CLIP-seq
MIRT2497101	hsa-miR-4797-5p	CLIP-seq
MIRT1956188	hsa-miR-495	CLIP-seq
MIRT864319	hsa-miR-892a	CLIP-seq
MIRT2497095	hsa-miR-3064-3p	CLIP-seq
MIRT2497102	hsa-miR-4768-5p	CLIP-seq
MIRT2497095	hsa-miR-3064-3p	CLIP-seq
MIRT2497095	hsa-miR-3064-3p	CLIP-seq
MIRT2497095	hsa-miR-3064-3p	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004866	Function	Endopeptidase inhibitor activity	TAS	7638179
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	17474147, 24462690
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005829	Component	Cytosol	IDA	14559243
GO:0005829	Component	Cytosol	TAS
GO:0010859	Function	Calcium-dependent cysteine-type endopeptidase inhibitor activity	IBA
GO:0010859	Function	Calcium-dependent cysteine-type endopeptidase inhibitor activity	IMP	2407243
GO:0016020	Component	Membrane	IDA	14559243
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:1990709	Process	Presynaptic active zone organization	IDA	27626661
GO:2000675	Process	Negative regulation of type B pancreatic cell apoptotic process	IDA	15044459

MIM	HGNC	e!Ensembl
114090	1515	ENSG00000310517

Protein

UniProt ID

P20810

Protein name

Calpastatin (Calpain inhibitor) (Sperm BS-17 component)

Protein function

Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00748	Calpain_inhib	71 → 225	Calpain inhibitor	Family
PF00748	Calpain_inhib	232 → 358	Calpain inhibitor	Family
PF00748	Calpain_inhib	369 → 500	Calpain inhibitor	Family
PF00748	Calpain_inhib	512 → 639	Calpain inhibitor	Family

Sequence

MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEH
TEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAI
SGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGP
EVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFT
CGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGT
RQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKP
KPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPP
EPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPD
YRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAIS
EVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAK
AEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDS
CPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD

Sequence length

708

Interactions

View interactions

	KEGG		Reactome
	Shigellosis		Degradation of the extracellular matrix Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Peeling Skin With Leukonychia, Acral Punctate Keratoses, Cheilitis, And Knuckle Pads	Peeling skin-leukonuchia-acral punctate keratoses-cheilitis-knuckle pads syndrome	rs786205140, rs786204842, rs786205141	N/A

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Heart Failure	Heart failure	N/A	N/A	GWAS
Iritis	Iritis	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS
Uveitis	Uveitis, Anterior uveitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	24200051
Arthritis Rheumatoid	Associate	15654835, 17324966, 22046434, 7706496
Bone Diseases Metabolic	Associate	21424381
Breast Neoplasms	Associate	21531560, 23684705, 27323818
Burns	Associate	22079905
Carcinoma Small Cell	Associate	27456359
Cardiomyopathies	Associate	12576481
Cheilitis	Associate	25683118
Cystic Fibrosis	Stimulate	14612448
Cystic Fibrosis	Associate	21983488
Epidermal Cyst	Associate	25683118
Glioblastoma	Associate	31262726, 39684695
Glioma	Associate	30504225
Inflammation	Associate	15654835, 23875735
Keratoconus	Associate	23449483, 39186261
Keratosis	Associate	25683118
Laryngeal Neoplasms	Associate	27456359
Leukemia Lymphocytic Chronic B Cell	Associate	12176903
Leukemia Myeloid	Associate	2462432
Leukemia Myeloid Acute	Associate	27294874
Leukemia T Cell	Associate	2462432
Liver Cirrhosis Biliary	Associate	7706496
Multiple Sclerosis	Associate	17765980
Myelodysplastic Syndromes	Associate	27294874
Neoplasm Invasiveness	Associate	21531560
Neoplasms	Associate	19946123, 39684695
Nerve Degeneration	Associate	23875735, 24200051
Neuroblastoma	Associate	7957886
Ovarian Neoplasms	Associate	30448882
Pancreatic Neoplasms	Associate	23140395
Parkinson Disease	Associate	19365859, 20127884, 23875735, 23951044
Peeling Skin Syndrome	Associate	30032785
Personality Disorders	Associate	27456359
Psoriasis	Associate	15654835
Respiratory Sounds	Associate	39186261
Rheumatic Diseases	Associate	7706496
Stomach Neoplasms	Associate	24589339, 35625600
Urinary Bladder Neoplasms	Associate	35462469

CAST (calpastatin)