KLRC4 (killer cell lectin like receptor C4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 8302
Gene name Killer cell lectin like receptor C4
Gene symbol KLRC4
Synonyms (NCBI Gene)
NKG2-FNKG2F
Chromosome 12
Chromosome location 12p13.2
Summary Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
11
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (11)
miRTarBase ID miRNA Experiments Reference
MIRT018052 hsa-miR-335-5p Microarray 18185580
MIRT025173 hsa-miR-181a-5p Microarray 17612493
MIRT029577 hsa-miR-26b-5p Microarray 19088304
MIRT450180 hsa-miR-302a-5p PAR-CLIP 22100165
MIRT448698 hsa-miR-570-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (5)
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IBA
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0009897 Component External side of plasma membrane IBA
GO:0016020 Component Membrane IEA
GO:0045954 Process Positive regulation of natural killer cell mediated cytotoxicity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
602893 6377 ENSG00000183542
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43908
Protein name NKG2-F type II integral membrane protein (NK cell receptor F) (NKG2-F-activating NK receptor)
Protein function May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Natural killer cells.
Sequence 
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYH
CKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHC
PEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
Sequence length 158
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG 
  Antigen processing and presentation