KLRC4 (killer cell lectin like receptor C4)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8302
Gene name Gene Name - the full gene name approved by the HGNC.
Killer cell lectin like receptor C4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLRC4
Synonyms (NCBI Gene) Gene synonyms aliases
NKG2-F, NKG2F
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT018052 hsa-miR-335-5p Microarray 18185580
MIRT025173 hsa-miR-181a-5p Microarray 17612493
MIRT029577 hsa-miR-26b-5p Microarray 19088304
MIRT450180 hsa-miR-302a-5p PAR-CLIP 22100165
MIRT448698 hsa-miR-570-3p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IBA
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0009897 Component External side of plasma membrane IBA
GO:0016020 Component Membrane IEA
GO:0045954 Process Positive regulation of natural killer cell mediated cytotoxicity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
602893 6377 ENSG00000183542
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID O43908
Protein name NKG2-F type II integral membrane protein (NK cell receptor F) (NKG2-F-activating NK receptor)
Protein function May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Natural killer cells.
Sequence 
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYH
CKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHC
PEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
Sequence length 158
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  
  Antigen processing and presentation  
<