Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8292
Gene name Gene Name - the full gene name approved by the HGNC.
Collagen like tail subunit of asymmetric acetylcholinesterase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COLQ
Synonyms (NCBI Gene) Gene synonyms aliases
CMS5, EAD
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CMS5
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p25.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcho
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104893733 C>A Pathogenic Stop gained, coding sequence variant
rs104893734 G>C Pathogenic Stop gained, coding sequence variant
rs104893735 C>A Pathogenic Stop gained, coding sequence variant
rs121908922 T>A,C Pathogenic Stop gained, missense variant, coding sequence variant
rs121908923 T>C,G Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017367 hsa-miR-335-5p Microarray 18185580
MIRT903266 hsa-miR-1264 CLIP-seq
MIRT903267 hsa-miR-1273g CLIP-seq
MIRT903268 hsa-miR-1285 CLIP-seq
MIRT903269 hsa-miR-1343 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001507 Process Acetylcholine catabolic process in synaptic cleft TAS 9689136
GO:0005201 Function Extracellular matrix structural constituent IBA 21873635
GO:0005201 Function Extracellular matrix structural constituent RCA 25037231
GO:0005515 Function Protein binding IPI 15526038, 32296183
GO:0005581 Component Collagen trimer IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603033 2226 ENSG00000206561
Protein
UniProt ID Q9Y215
Protein name Acetylcholinesterase collagenic tail peptide (AChE Q subunit) (Acetylcholinesterase-associated collagen)
Protein function Anchors the catalytic subunits of asymmetric AChE to the synaptic basal lamina.
PDB 1VZJ
Family and domains
Tissue specificity TISSUE SPECIFICITY: Found at the end plate of skeletal muscle.
Sequence
MVVLNPMTLGIYLQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPP
LFPPPFFRGGRSPLLSPDMKNLMLELETSQSPCMQGSLGSPGPPGPQGPPGLPGKTGPKG
EKGELGRPGRKGRPGPPGVPGMPGPIGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGYPG
SRGEKGSRGEKGDLGPKGEKGFPGFPGMLGQKGEMGPKGEPGIAGHRGPTGRPGKRGKQG
QKGDSGVMGPPGKPGPSGQPGRPGPPGPPPAGQLIMGPKGERGFPGPPGRCLCGPTMNVN
NPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLT
PFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGS
DFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT
Sequence length 455
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Myasthenia gravis Myasthenias rs5030818, rs121912815, rs121912817, rs121912818, rs121912821, rs75466054, rs121912822, rs121912823, rs794727516, rs764497513, rs376808313, rs1279554995, rs1554802792, rs369251527, rs372760913
View all (8 more)
Myasthenic syndrome Myasthenic Syndromes, Congenital rs606231128, rs606231129, rs606231130, rs606231131, rs606231132, rs118203994, rs118203995, rs863223277, rs606231133, rs121908547, rs121908553, rs121908557, rs104893733, rs104893734, rs121908922
View all (237 more)
9689136, 24281389, 22678886
Unknown
Disease term Disease name Evidence References Source
Ptosis Blepharoptosis, Ptosis ClinVar
Myasthenic Syndrome congenital myasthenic syndrome 5 GenCC
Pancreatic cancer Pancreatic cancer Genome-Wide CRISPR Screening Identifies DCK and CCNL1 as Genes That Contribute to Gemcitabine Resistance in Pancreatic Cancer GWAS, CBGDA
Diverticulitis Diverticulitis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Atrial Fibrillation Associate 34737791
Congenital disorder of glycosylation type 1C Associate 9758617
Congenital myasthenic syndrome ib Associate 33353066
Diverticular Diseases Associate 28585551
Diverticulitis Associate 28585551
Drug Related Side Effects and Adverse Reactions Stimulate 15015577
Endplate Acetylcholinesterase Deficiency Associate 22088788, 26282582, 33370874, 34553317, 9758617
Epstein Barr Virus Infections Associate 1316087, 36286483, 38146370
Lupus Erythematosus Systemic Associate 37841281, 38146370
Muscle Weakness Associate 22088788