Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8289
Gene name Gene Name - the full gene name approved by the HGNC.	AT-rich interaction domain 1A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ARID1A
Synonyms (NCBI Gene) Gene synonyms aliases	B120, BAF250, BAF250a, BM029, C1orf4, CSS2, ELD, MRD14, OSA1, P270, SMARCF1, hELD, hOSA1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large

Show/Hide all(35)

SNP ID	Visualize variation	Clinical significance	Consequence
rs375761808	A>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs387906845	C>T	Pathogenic	Coding sequence variant, stop gained
rs387906846	C>G,T	Pathogenic	Coding sequence variant, missense variant, stop gained
rs797045262	AGCAGCCTGGGCAACCCGCCGCCGCC>-	Pathogenic	Coding sequence variant, frameshift variant
rs797045263	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs797045264	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs869312956	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs875989848	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs875989849	G>T	Pathogenic	Coding sequence variant, stop gained
rs878853088	C>T	Pathogenic	Coding sequence variant, stop gained
rs879255270	C>T	Pathogenic	Coding sequence variant, stop gained
rs886042036	G>A	Pathogenic	Splice donor variant
rs1057520585	C>T	Pathogenic	Stop gained, coding sequence variant
rs1057523568	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1064794151	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064795682	CTTTGAG>ACATGCAGAAC	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1064796010	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1064796564	G>A	Likely-pathogenic	Intron variant
rs1085307923	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1485978447	C>A,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs1553146165	CTACCAGGGCTACCCCGGGG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1553153130	GGG>CTAGGA	Pathogenic	Coding sequence variant, stop gained
rs1553153231	C>T	Drug-response	Intron variant, coding sequence variant, stop gained
rs1553153291	->A	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1553153770	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1553153771	C>A	Not-provided, likely-pathogenic	Coding sequence variant, missense variant
rs1557570794	->GCCGCCTCCCTCCTCCAGCGCC	Pathogenic	Coding sequence variant, frameshift variant
rs1557591264	C>T	Pathogenic	Stop gained, coding sequence variant
rs1557612048	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1557620758	AAGTG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1570607996	G>A	Pathogenic	Splice acceptor variant
rs1570609440	G>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1570621899	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1570622663	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1570623368	GTTTA>-	Likely-pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(798)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001385	hsa-miR-1-3p	pSILAC	18668040
MIRT004027	hsa-miR-101-3p	Western blot	19008416
MIRT004027	hsa-miR-101-3p	Western blot	19008416
MIRT004027	hsa-miR-101-3p	Western blot	19008416
MIRT004027	hsa-miR-101-3p	Western blot	19008416
MIRT001385	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT024162	hsa-miR-221-3p	Sequencing	20371350
MIRT004027	hsa-miR-101-3p	Sequencing	20371350
MIRT027653	hsa-miR-98-5p	Microarray	19088304
MIRT051608	hsa-let-7e-5p	CLASH	23622248
MIRT049171	hsa-miR-92a-3p	CLASH	23622248
MIRT049171	hsa-miR-92a-3p	CLASH	23622248
MIRT043438	hsa-miR-331-3p	CLASH	23622248
MIRT042943	hsa-miR-324-3p	CLASH	23622248
MIRT042203	hsa-miR-484	CLASH	23622248
MIRT041580	hsa-miR-193b-3p	CLASH	23622248
MIRT040907	hsa-miR-18a-3p	CLASH	23622248
MIRT038669	hsa-miR-181a-2-3p	CLASH	23622248
MIRT038464	hsa-miR-296-3p	CLASH	23622248
MIRT036956	hsa-miR-877-3p	CLASH	23622248
MIRT248732	hsa-miR-31-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24793973
MIRT248732	hsa-miR-31-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24793973
MIRT248732	hsa-miR-31-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24793973
MIRT248732	hsa-miR-31-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24793973
MIRT689026	hsa-miR-4750-3p	HITS-CLIP	23313552
MIRT689025	hsa-miR-1180-5p	HITS-CLIP	23313552
MIRT689024	hsa-miR-7114-3p	HITS-CLIP	23313552
MIRT689023	hsa-miR-628-5p	HITS-CLIP	23313552
MIRT689022	hsa-miR-4743-3p	HITS-CLIP	23313552
MIRT689021	hsa-miR-4652-3p	HITS-CLIP	23313552
MIRT562652	hsa-miR-548ac	HITS-CLIP	23824327
MIRT562651	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT562650	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT562649	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT562648	hsa-miR-548z	HITS-CLIP	23824327
MIRT562647	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT562646	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT562645	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT562644	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT562643	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT562642	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT562641	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT660534	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT660533	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT562656	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT562655	hsa-miR-5692a	PAR-CLIP	20371350
MIRT188337	hsa-miR-4649-3p	PAR-CLIP	20371350
MIRT188342	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT405485	hsa-miR-7854-3p	PAR-CLIP	20371350
MIRT188339	hsa-miR-6134	PAR-CLIP	20371350
MIRT562654	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT188335	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT188326	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT188327	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT188328	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT568486	hsa-miR-4303	PAR-CLIP	20371350
MIRT562653	hsa-miR-448	PAR-CLIP	20371350
MIRT188334	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT188332	hsa-miR-507	PAR-CLIP	20371350
MIRT188333	hsa-miR-557	PAR-CLIP	20371350
MIRT188336	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT562652	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562651	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562650	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562649	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562648	hsa-miR-548z	PAR-CLIP	20371350
MIRT562647	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562646	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562645	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562644	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562643	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562642	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562641	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT066772	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT562640	hsa-miR-4708-3p	PAR-CLIP	20371350
MIRT066773	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT066777	hsa-miR-3688-5p	PAR-CLIP	20371350
MIRT066774	hsa-miR-891a-3p	PAR-CLIP	20371350
MIRT066779	hsa-miR-4642	PAR-CLIP	20371350
MIRT562656	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT562655	hsa-miR-5692a	PAR-CLIP	20371350
MIRT188337	hsa-miR-4649-3p	PAR-CLIP	20371350
MIRT188342	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT405485	hsa-miR-7854-3p	PAR-CLIP	20371350
MIRT188339	hsa-miR-6134	PAR-CLIP	20371350
MIRT562654	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT188335	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT188326	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT188327	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT188328	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT562653	hsa-miR-448	PAR-CLIP	20371350
MIRT188334	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT188332	hsa-miR-507	PAR-CLIP	20371350
MIRT188333	hsa-miR-557	PAR-CLIP	20371350
MIRT188336	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT562652	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562651	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562650	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562649	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562648	hsa-miR-548z	PAR-CLIP	20371350
MIRT562647	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562646	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562645	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562644	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562643	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562642	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562641	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT066772	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT562640	hsa-miR-4708-3p	PAR-CLIP	20371350
MIRT066773	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT066777	hsa-miR-3688-5p	PAR-CLIP	20371350
MIRT066774	hsa-miR-891a-3p	PAR-CLIP	20371350
MIRT066779	hsa-miR-4642	PAR-CLIP	20371350
MIRT004027	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT004027	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT066784	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT248727	hsa-miR-1182	PAR-CLIP	20371350
MIRT188344	hsa-miR-5681a	PAR-CLIP	20371350
MIRT562639	hsa-miR-6730-5p	PAR-CLIP	20371350
MIRT562638	hsa-miR-3618	PAR-CLIP	20371350
MIRT066789	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT188343	hsa-miR-488-3p	PAR-CLIP	20371350
MIRT066782	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT066783	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT066801	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT066808	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT494691	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT066803	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT066806	hsa-miR-4784	PAR-CLIP	23592263
MIRT494690	hsa-miR-4533	PAR-CLIP	23592263
MIRT494689	hsa-miR-3202	PAR-CLIP	23592263
MIRT066794	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT066802	hsa-miR-4306	PAR-CLIP	23592263
MIRT066805	hsa-miR-4644	PAR-CLIP	23592263
MIRT066799	hsa-miR-765	PAR-CLIP	23592263
MIRT494688	hsa-miR-3190-3p	PAR-CLIP	23592263
MIRT481596	hsa-miR-377-3p	PAR-CLIP	23592263
MIRT339122	hsa-miR-485-3p	PAR-CLIP	23592263
MIRT339123	hsa-miR-539-3p	PAR-CLIP	23592263
MIRT066797	hsa-miR-583	PAR-CLIP	23592263
MIRT066801	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT066808	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT188347	hsa-miR-4666a-3p	PAR-CLIP	23592263
MIRT339131	hsa-miR-664a-3p	PAR-CLIP	23592263
MIRT481595	hsa-miR-6830-5p	PAR-CLIP	23592263
MIRT405483	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT481594	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT405480	hsa-miR-1266-5p	PAR-CLIP	23592263
MIRT405481	hsa-miR-4518	PAR-CLIP	23592263
MIRT066803	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT066806	hsa-miR-4784	PAR-CLIP	23592263
MIRT405482	hsa-miR-4695-3p	PAR-CLIP	23592263
MIRT066794	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT066802	hsa-miR-4306	PAR-CLIP	23592263
MIRT066805	hsa-miR-4644	PAR-CLIP	23592263
MIRT066799	hsa-miR-765	PAR-CLIP	23592263
MIRT066798	hsa-miR-609	PAR-CLIP	23592263
MIRT481593	hsa-miR-3613-5p	PAR-CLIP	23592263
MIRT066796	hsa-miR-561-5p	PAR-CLIP	23592263
MIRT405484	hsa-miR-7641	PAR-CLIP	23592263
MIRT066795	hsa-miR-135b-3p	PAR-CLIP	23592263
MIRT441193	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT441191	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441193	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT441191	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT274774	hsa-miR-222-3p	Luciferase reporter assay	26909602
MIRT274774	hsa-miR-222-3p	Luciferase reporter assay	26909602
MIRT066782	hsa-let-7a-2-3p	PAR-CLIP	26701625
MIRT066782	hsa-let-7a-2-3p	PAR-CLIP	26701625
MIRT066783	hsa-let-7g-3p	PAR-CLIP	26701625
MIRT066783	hsa-let-7g-3p	PAR-CLIP	26701625
MIRT004027	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT004027	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT248727	hsa-miR-1182	PAR-CLIP	26701625
MIRT248727	hsa-miR-1182	PAR-CLIP	26701625
MIRT066784	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT066784	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT066789	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT066789	hsa-miR-3177-5p	PAR-CLIP	26701625
MIRT562638	hsa-miR-3618	PAR-CLIP	26701625
MIRT562638	hsa-miR-3618	PAR-CLIP	26701625
MIRT188343	hsa-miR-488-3p	PAR-CLIP	26701625
MIRT188343	hsa-miR-488-3p	PAR-CLIP	26701625
MIRT188344	hsa-miR-5681a	PAR-CLIP	26701625
MIRT188344	hsa-miR-5681a	PAR-CLIP	26701625
MIRT562639	hsa-miR-6730-5p	PAR-CLIP	26701625
MIRT562639	hsa-miR-6730-5p	PAR-CLIP	26701625
MIRT562652	hsa-miR-548ac	HITS-CLIP	27418678
MIRT562647	hsa-miR-548ae-3p	HITS-CLIP	27418678
MIRT562646	hsa-miR-548ah-3p	HITS-CLIP	27418678
MIRT562645	hsa-miR-548aj-3p	HITS-CLIP	27418678
MIRT562644	hsa-miR-548am-3p	HITS-CLIP	27418678
MIRT562643	hsa-miR-548aq-3p	HITS-CLIP	27418678
MIRT562651	hsa-miR-548bb-3p	HITS-CLIP	27418678
MIRT562650	hsa-miR-548d-3p	HITS-CLIP	27418678
MIRT562649	hsa-miR-548h-3p	HITS-CLIP	27418678
MIRT562642	hsa-miR-548j-3p	HITS-CLIP	27418678
MIRT562641	hsa-miR-548x-3p	HITS-CLIP	27418678
MIRT562648	hsa-miR-548z	HITS-CLIP	27418678
MIRT689026	hsa-miR-4750-3p	HITS-CLIP	23313552
MIRT689025	hsa-miR-1180-5p	HITS-CLIP	23313552
MIRT689024	hsa-miR-7114-3p	HITS-CLIP	23313552
MIRT689023	hsa-miR-628-5p	HITS-CLIP	23313552
MIRT689022	hsa-miR-4743-3p	HITS-CLIP	23313552
MIRT689021	hsa-miR-4652-3p	HITS-CLIP	23313552
MIRT562652	hsa-miR-548ac	HITS-CLIP	23824327
MIRT562651	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT562650	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT562649	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT562648	hsa-miR-548z	HITS-CLIP	23824327
MIRT562647	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT562646	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT562645	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT562644	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT562643	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT562642	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT562641	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT660534	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT660533	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT562656	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT562655	hsa-miR-5692a	PAR-CLIP	20371350
MIRT188337	hsa-miR-4649-3p	PAR-CLIP	20371350
MIRT188342	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT405485	hsa-miR-7854-3p	PAR-CLIP	20371350
MIRT188339	hsa-miR-6134	PAR-CLIP	20371350
MIRT562654	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT188335	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT188326	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT188327	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT188328	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT568486	hsa-miR-4303	PAR-CLIP	20371350
MIRT562653	hsa-miR-448	PAR-CLIP	20371350
MIRT188334	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT188332	hsa-miR-507	PAR-CLIP	20371350
MIRT188333	hsa-miR-557	PAR-CLIP	20371350
MIRT188336	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT562652	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562651	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562650	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562649	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562648	hsa-miR-548z	PAR-CLIP	20371350
MIRT562647	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562646	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562645	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562644	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562643	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562642	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562641	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT066772	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT562640	hsa-miR-4708-3p	PAR-CLIP	20371350
MIRT066773	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT066777	hsa-miR-3688-5p	PAR-CLIP	20371350
MIRT066774	hsa-miR-891a-3p	PAR-CLIP	20371350
MIRT066779	hsa-miR-4642	PAR-CLIP	20371350
MIRT562656	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT562655	hsa-miR-5692a	PAR-CLIP	20371350
MIRT188337	hsa-miR-4649-3p	PAR-CLIP	20371350
MIRT188342	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT405485	hsa-miR-7854-3p	PAR-CLIP	20371350
MIRT188339	hsa-miR-6134	PAR-CLIP	20371350
MIRT562654	hsa-miR-196a-3p	PAR-CLIP	20371350
MIRT188335	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT188326	hsa-miR-19a-5p	PAR-CLIP	20371350
MIRT188327	hsa-miR-19b-1-5p	PAR-CLIP	20371350
MIRT188328	hsa-miR-19b-2-5p	PAR-CLIP	20371350
MIRT562653	hsa-miR-448	PAR-CLIP	20371350
MIRT188334	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT188332	hsa-miR-507	PAR-CLIP	20371350
MIRT188333	hsa-miR-557	PAR-CLIP	20371350
MIRT188336	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT562652	hsa-miR-548ac	PAR-CLIP	20371350
MIRT562651	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT562650	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT562649	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT562648	hsa-miR-548z	PAR-CLIP	20371350
MIRT562647	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT562646	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT562645	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT562644	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT562643	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT562642	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT562641	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT066772	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT562640	hsa-miR-4708-3p	PAR-CLIP	20371350
MIRT066773	hsa-miR-324-5p	PAR-CLIP	20371350
MIRT066777	hsa-miR-3688-5p	PAR-CLIP	20371350
MIRT066774	hsa-miR-891a-3p	PAR-CLIP	20371350
MIRT066779	hsa-miR-4642	PAR-CLIP	20371350
MIRT004027	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT004027	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT066784	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT248727	hsa-miR-1182	PAR-CLIP	20371350
MIRT188344	hsa-miR-5681a	PAR-CLIP	20371350
MIRT562639	hsa-miR-6730-5p	PAR-CLIP	20371350
MIRT562638	hsa-miR-3618	PAR-CLIP	20371350
MIRT066789	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT188343	hsa-miR-488-3p	PAR-CLIP	20371350
MIRT066782	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT066783	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT066801	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT066808	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT494691	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT066803	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT066806	hsa-miR-4784	PAR-CLIP	23592263
MIRT494690	hsa-miR-4533	PAR-CLIP	23592263
MIRT494689	hsa-miR-3202	PAR-CLIP	23592263
MIRT066794	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT066802	hsa-miR-4306	PAR-CLIP	23592263
MIRT066805	hsa-miR-4644	PAR-CLIP	23592263
MIRT066799	hsa-miR-765	PAR-CLIP	23592263
MIRT494688	hsa-miR-3190-3p	PAR-CLIP	23592263
MIRT481596	hsa-miR-377-3p	PAR-CLIP	23592263
MIRT339122	hsa-miR-485-3p	PAR-CLIP	23592263
MIRT339123	hsa-miR-539-3p	PAR-CLIP	23592263
MIRT066797	hsa-miR-583	PAR-CLIP	23592263
MIRT066801	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT066808	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT188347	hsa-miR-4666a-3p	PAR-CLIP	23592263
MIRT339131	hsa-miR-664a-3p	PAR-CLIP	23592263
MIRT481595	hsa-miR-6830-5p	PAR-CLIP	23592263
MIRT405483	hsa-miR-6823-5p	PAR-CLIP	23592263
MIRT481594	hsa-miR-3664-3p	PAR-CLIP	23592263
MIRT405480	hsa-miR-1266-5p	PAR-CLIP	23592263
MIRT405481	hsa-miR-4518	PAR-CLIP	23592263
MIRT066803	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT066806	hsa-miR-4784	PAR-CLIP	23592263
MIRT405482	hsa-miR-4695-3p	PAR-CLIP	23592263
MIRT066794	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT066802	hsa-miR-4306	PAR-CLIP	23592263
MIRT066805	hsa-miR-4644	PAR-CLIP	23592263
MIRT066799	hsa-miR-765	PAR-CLIP	23592263
MIRT066798	hsa-miR-609	PAR-CLIP	23592263
MIRT481593	hsa-miR-3613-5p	PAR-CLIP	23592263
MIRT066796	hsa-miR-561-5p	PAR-CLIP	23592263
MIRT405484	hsa-miR-7641	PAR-CLIP	23592263
MIRT066795	hsa-miR-135b-3p	PAR-CLIP	23592263
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796201	hsa-miR-1184	CLIP-seq
MIRT796202	hsa-miR-1200	CLIP-seq
MIRT796203	hsa-miR-1228	CLIP-seq
MIRT796204	hsa-miR-1243	CLIP-seq
MIRT796205	hsa-miR-1257	CLIP-seq
MIRT796206	hsa-miR-125a-3p	CLIP-seq
MIRT796207	hsa-miR-1264	CLIP-seq
MIRT796208	hsa-miR-1266	CLIP-seq
MIRT796209	hsa-miR-1301	CLIP-seq
MIRT796210	hsa-miR-1305	CLIP-seq
MIRT796211	hsa-miR-132	CLIP-seq
MIRT796212	hsa-miR-142-5p	CLIP-seq
MIRT796213	hsa-miR-144	CLIP-seq
MIRT796214	hsa-miR-153	CLIP-seq
MIRT796215	hsa-miR-1825	CLIP-seq
MIRT796216	hsa-miR-185	CLIP-seq
MIRT796217	hsa-miR-18a	CLIP-seq
MIRT796218	hsa-miR-18b	CLIP-seq
MIRT796219	hsa-miR-1976	CLIP-seq
MIRT796220	hsa-miR-199a-5p	CLIP-seq
MIRT796221	hsa-miR-199b-5p	CLIP-seq
MIRT796222	hsa-miR-19a	CLIP-seq
MIRT796223	hsa-miR-19b	CLIP-seq
MIRT796224	hsa-miR-203	CLIP-seq
MIRT796225	hsa-miR-2053	CLIP-seq
MIRT796226	hsa-miR-212	CLIP-seq
MIRT796227	hsa-miR-214	CLIP-seq
MIRT796228	hsa-miR-216a	CLIP-seq
MIRT796229	hsa-miR-217	CLIP-seq
MIRT796230	hsa-miR-223	CLIP-seq
MIRT796231	hsa-miR-2276	CLIP-seq
MIRT796232	hsa-miR-2682	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT796234	hsa-miR-3151	CLIP-seq
MIRT796235	hsa-miR-3153	CLIP-seq
MIRT796236	hsa-miR-3168	CLIP-seq
MIRT796237	hsa-miR-3169	CLIP-seq
MIRT796238	hsa-miR-3184	CLIP-seq
MIRT796239	hsa-miR-3192	CLIP-seq
MIRT796240	hsa-miR-320e	CLIP-seq
MIRT796241	hsa-miR-329	CLIP-seq
MIRT796242	hsa-miR-340	CLIP-seq
MIRT796243	hsa-miR-34c-3p	CLIP-seq
MIRT796244	hsa-miR-3607-5p	CLIP-seq
MIRT796245	hsa-miR-3611	CLIP-seq
MIRT796246	hsa-miR-3619-5p	CLIP-seq
MIRT796247	hsa-miR-362-3p	CLIP-seq
MIRT796248	hsa-miR-3668	CLIP-seq
MIRT796249	hsa-miR-3689a-3p	CLIP-seq
MIRT796250	hsa-miR-3689c	CLIP-seq
MIRT796251	hsa-miR-3689d	CLIP-seq
MIRT796252	hsa-miR-377	CLIP-seq
MIRT796253	hsa-miR-382	CLIP-seq
MIRT796254	hsa-miR-3925-3p	CLIP-seq
MIRT796255	hsa-miR-3934	CLIP-seq
MIRT796256	hsa-miR-3936	CLIP-seq
MIRT796257	hsa-miR-3941	CLIP-seq
MIRT796258	hsa-miR-423-5p	CLIP-seq
MIRT796259	hsa-miR-4263	CLIP-seq
MIRT796260	hsa-miR-4274	CLIP-seq
MIRT796261	hsa-miR-4277	CLIP-seq
MIRT796262	hsa-miR-4291	CLIP-seq
MIRT796263	hsa-miR-4307	CLIP-seq
MIRT796264	hsa-miR-4318	CLIP-seq
MIRT796265	hsa-miR-4320	CLIP-seq
MIRT796266	hsa-miR-4324	CLIP-seq
MIRT796267	hsa-miR-4328	CLIP-seq
MIRT796268	hsa-miR-4329	CLIP-seq
MIRT796269	hsa-miR-4418	CLIP-seq
MIRT796270	hsa-miR-4420	CLIP-seq
MIRT796271	hsa-miR-4434	CLIP-seq
MIRT796272	hsa-miR-4446-5p	CLIP-seq
MIRT796273	hsa-miR-4447	CLIP-seq
MIRT796274	hsa-miR-4450	CLIP-seq
MIRT796275	hsa-miR-4472	CLIP-seq
MIRT796276	hsa-miR-449c	CLIP-seq
MIRT796277	hsa-miR-4509	CLIP-seq
MIRT796278	hsa-miR-4515	CLIP-seq
MIRT796279	hsa-miR-4516	CLIP-seq
MIRT796280	hsa-miR-4520a-3p	CLIP-seq
MIRT796281	hsa-miR-455-5p	CLIP-seq
MIRT796282	hsa-miR-4638-3p	CLIP-seq
MIRT796283	hsa-miR-4643	CLIP-seq
MIRT796284	hsa-miR-4646-5p	CLIP-seq
MIRT796285	hsa-miR-4650-5p	CLIP-seq
MIRT796286	hsa-miR-4659a-3p	CLIP-seq
MIRT796287	hsa-miR-4659b-3p	CLIP-seq
MIRT796288	hsa-miR-4660	CLIP-seq
MIRT796289	hsa-miR-4663	CLIP-seq
MIRT796290	hsa-miR-4666-3p	CLIP-seq
MIRT796291	hsa-miR-4668-5p	CLIP-seq
MIRT796292	hsa-miR-4696	CLIP-seq
MIRT796293	hsa-miR-4704-3p	CLIP-seq
MIRT796294	hsa-miR-4709-5p	CLIP-seq
MIRT796295	hsa-miR-4713-3p	CLIP-seq
MIRT796296	hsa-miR-4716-5p	CLIP-seq
MIRT796297	hsa-miR-4723-5p	CLIP-seq
MIRT796298	hsa-miR-4728-5p	CLIP-seq
MIRT796299	hsa-miR-4735-3p	CLIP-seq
MIRT796300	hsa-miR-4751	CLIP-seq
MIRT796301	hsa-miR-4757-5p	CLIP-seq
MIRT796302	hsa-miR-4764-3p	CLIP-seq
MIRT796303	hsa-miR-4789-5p	CLIP-seq
MIRT796304	hsa-miR-4795-3p	CLIP-seq
MIRT796305	hsa-miR-488	CLIP-seq
MIRT796306	hsa-miR-491-5p	CLIP-seq
MIRT796307	hsa-miR-5047	CLIP-seq
MIRT796308	hsa-miR-509-3-5p	CLIP-seq
MIRT796309	hsa-miR-509-3p	CLIP-seq
MIRT796310	hsa-miR-509-5p	CLIP-seq
MIRT796311	hsa-miR-5096	CLIP-seq
MIRT796312	hsa-miR-511	CLIP-seq
MIRT796313	hsa-miR-513b	CLIP-seq
MIRT796314	hsa-miR-515-5p	CLIP-seq
MIRT796315	hsa-miR-544b	CLIP-seq
MIRT796316	hsa-miR-548aa	CLIP-seq
MIRT796317	hsa-miR-548c-3p	CLIP-seq
MIRT796318	hsa-miR-548g	CLIP-seq
MIRT796319	hsa-miR-548m	CLIP-seq
MIRT796320	hsa-miR-556-3p	CLIP-seq
MIRT796321	hsa-miR-567	CLIP-seq
MIRT796322	hsa-miR-570	CLIP-seq
MIRT796323	hsa-miR-576-5p	CLIP-seq
MIRT796324	hsa-miR-582-5p	CLIP-seq
MIRT796325	hsa-miR-587	CLIP-seq
MIRT796326	hsa-miR-598	CLIP-seq
MIRT796327	hsa-miR-602	CLIP-seq
MIRT796328	hsa-miR-603	CLIP-seq
MIRT796329	hsa-miR-604	CLIP-seq
MIRT796330	hsa-miR-607	CLIP-seq
MIRT796331	hsa-miR-647	CLIP-seq
MIRT796332	hsa-miR-653	CLIP-seq
MIRT796333	hsa-miR-664	CLIP-seq
MIRT796334	hsa-miR-761	CLIP-seq
MIRT796335	hsa-miR-764	CLIP-seq
MIRT796336	hsa-miR-766	CLIP-seq
MIRT796337	hsa-miR-885-3p	CLIP-seq
MIRT796338	hsa-miR-922	CLIP-seq
MIRT796339	hsa-miR-940	CLIP-seq
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796201	hsa-miR-1184	CLIP-seq
MIRT796202	hsa-miR-1200	CLIP-seq
MIRT796203	hsa-miR-1228	CLIP-seq
MIRT796204	hsa-miR-1243	CLIP-seq
MIRT796205	hsa-miR-1257	CLIP-seq
MIRT796209	hsa-miR-1301	CLIP-seq
MIRT796210	hsa-miR-1305	CLIP-seq
MIRT796211	hsa-miR-132	CLIP-seq
MIRT796212	hsa-miR-142-5p	CLIP-seq
MIRT796213	hsa-miR-144	CLIP-seq
MIRT796214	hsa-miR-153	CLIP-seq
MIRT796215	hsa-miR-1825	CLIP-seq
MIRT796219	hsa-miR-1976	CLIP-seq
MIRT796220	hsa-miR-199a-5p	CLIP-seq
MIRT796221	hsa-miR-199b-5p	CLIP-seq
MIRT796222	hsa-miR-19a	CLIP-seq
MIRT796223	hsa-miR-19b	CLIP-seq
MIRT796226	hsa-miR-212	CLIP-seq
MIRT796230	hsa-miR-223	CLIP-seq
MIRT796231	hsa-miR-2276	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT796236	hsa-miR-3168	CLIP-seq
MIRT796240	hsa-miR-320e	CLIP-seq
MIRT796241	hsa-miR-329	CLIP-seq
MIRT796242	hsa-miR-340	CLIP-seq
MIRT796244	hsa-miR-3607-5p	CLIP-seq
MIRT796245	hsa-miR-3611	CLIP-seq
MIRT796247	hsa-miR-362-3p	CLIP-seq
MIRT796252	hsa-miR-377	CLIP-seq
MIRT796254	hsa-miR-3925-3p	CLIP-seq
MIRT796257	hsa-miR-3941	CLIP-seq
MIRT796259	hsa-miR-4263	CLIP-seq
MIRT796261	hsa-miR-4277	CLIP-seq
MIRT796263	hsa-miR-4307	CLIP-seq
MIRT796265	hsa-miR-4320	CLIP-seq
MIRT796266	hsa-miR-4324	CLIP-seq
MIRT796267	hsa-miR-4328	CLIP-seq
MIRT796271	hsa-miR-4434	CLIP-seq
MIRT796272	hsa-miR-4446-5p	CLIP-seq
MIRT796277	hsa-miR-4509	CLIP-seq
MIRT796279	hsa-miR-4516	CLIP-seq
MIRT796280	hsa-miR-4520a-3p	CLIP-seq
MIRT796281	hsa-miR-455-5p	CLIP-seq
MIRT796282	hsa-miR-4638-3p	CLIP-seq
MIRT796286	hsa-miR-4659a-3p	CLIP-seq
MIRT796287	hsa-miR-4659b-3p	CLIP-seq
MIRT796288	hsa-miR-4660	CLIP-seq
MIRT796292	hsa-miR-4696	CLIP-seq
MIRT796294	hsa-miR-4709-5p	CLIP-seq
MIRT1935120	hsa-miR-4724-5p	CLIP-seq
MIRT796303	hsa-miR-4789-5p	CLIP-seq
MIRT796304	hsa-miR-4795-3p	CLIP-seq
MIRT1935121	hsa-miR-4797-5p	CLIP-seq
MIRT1935122	hsa-miR-486-5p	CLIP-seq
MIRT796305	hsa-miR-488	CLIP-seq
MIRT796307	hsa-miR-5047	CLIP-seq
MIRT796311	hsa-miR-5096	CLIP-seq
MIRT796312	hsa-miR-511	CLIP-seq
MIRT796313	hsa-miR-513b	CLIP-seq
MIRT796314	hsa-miR-515-5p	CLIP-seq
MIRT796315	hsa-miR-544b	CLIP-seq
MIRT796316	hsa-miR-548aa	CLIP-seq
MIRT1935123	hsa-miR-548ae	CLIP-seq
MIRT1935124	hsa-miR-548aj	CLIP-seq
MIRT1935125	hsa-miR-548am	CLIP-seq
MIRT796318	hsa-miR-548g	CLIP-seq
MIRT796319	hsa-miR-548m	CLIP-seq
MIRT1935126	hsa-miR-548x	CLIP-seq
MIRT796320	hsa-miR-556-3p	CLIP-seq
MIRT796321	hsa-miR-567	CLIP-seq
MIRT796323	hsa-miR-576-5p	CLIP-seq
MIRT796324	hsa-miR-582-5p	CLIP-seq
MIRT796326	hsa-miR-598	CLIP-seq
MIRT796328	hsa-miR-603	CLIP-seq
MIRT796330	hsa-miR-607	CLIP-seq
MIRT796333	hsa-miR-664	CLIP-seq
MIRT796336	hsa-miR-766	CLIP-seq
MIRT1935127	hsa-miR-769-5p	CLIP-seq
MIRT796337	hsa-miR-885-3p	CLIP-seq
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796201	hsa-miR-1184	CLIP-seq
MIRT796204	hsa-miR-1243	CLIP-seq
MIRT796205	hsa-miR-1257	CLIP-seq
MIRT796206	hsa-miR-125a-3p	CLIP-seq
MIRT796207	hsa-miR-1264	CLIP-seq
MIRT796208	hsa-miR-1266	CLIP-seq
MIRT2175178	hsa-miR-129-5p	CLIP-seq
MIRT796209	hsa-miR-1301	CLIP-seq
MIRT796210	hsa-miR-1305	CLIP-seq
MIRT796211	hsa-miR-132	CLIP-seq
MIRT796212	hsa-miR-142-5p	CLIP-seq
MIRT796213	hsa-miR-144	CLIP-seq
MIRT796214	hsa-miR-153	CLIP-seq
MIRT796216	hsa-miR-185	CLIP-seq
MIRT796219	hsa-miR-1976	CLIP-seq
MIRT796222	hsa-miR-19a	CLIP-seq
MIRT796223	hsa-miR-19b	CLIP-seq
MIRT2175179	hsa-miR-205	CLIP-seq
MIRT796225	hsa-miR-2053	CLIP-seq
MIRT796226	hsa-miR-212	CLIP-seq
MIRT796227	hsa-miR-214	CLIP-seq
MIRT796230	hsa-miR-223	CLIP-seq
MIRT796231	hsa-miR-2276	CLIP-seq
MIRT2175180	hsa-miR-2355-3p	CLIP-seq
MIRT796232	hsa-miR-2682	CLIP-seq
MIRT2175181	hsa-miR-30a	CLIP-seq
MIRT2175182	hsa-miR-30b	CLIP-seq
MIRT2175183	hsa-miR-30c	CLIP-seq
MIRT2175184	hsa-miR-30d	CLIP-seq
MIRT2175185	hsa-miR-30e	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT796234	hsa-miR-3151	CLIP-seq
MIRT796236	hsa-miR-3168	CLIP-seq
MIRT796238	hsa-miR-3184	CLIP-seq
MIRT796239	hsa-miR-3192	CLIP-seq
MIRT796240	hsa-miR-320e	CLIP-seq
MIRT796241	hsa-miR-329	CLIP-seq
MIRT796242	hsa-miR-340	CLIP-seq
MIRT796245	hsa-miR-3611	CLIP-seq
MIRT796246	hsa-miR-3619-5p	CLIP-seq
MIRT796247	hsa-miR-362-3p	CLIP-seq
MIRT796248	hsa-miR-3668	CLIP-seq
MIRT796249	hsa-miR-3689a-3p	CLIP-seq
MIRT796250	hsa-miR-3689c	CLIP-seq
MIRT796252	hsa-miR-377	CLIP-seq
MIRT796255	hsa-miR-3934	CLIP-seq
MIRT796256	hsa-miR-3936	CLIP-seq
MIRT796257	hsa-miR-3941	CLIP-seq
MIRT796258	hsa-miR-423-5p	CLIP-seq
MIRT796259	hsa-miR-4263	CLIP-seq
MIRT796260	hsa-miR-4274	CLIP-seq
MIRT796261	hsa-miR-4277	CLIP-seq
MIRT796262	hsa-miR-4291	CLIP-seq
MIRT796263	hsa-miR-4307	CLIP-seq
MIRT796264	hsa-miR-4318	CLIP-seq
MIRT796265	hsa-miR-4320	CLIP-seq
MIRT796267	hsa-miR-4328	CLIP-seq
MIRT796268	hsa-miR-4329	CLIP-seq
MIRT796271	hsa-miR-4434	CLIP-seq
MIRT796272	hsa-miR-4446-5p	CLIP-seq
MIRT796273	hsa-miR-4447	CLIP-seq
MIRT796274	hsa-miR-4450	CLIP-seq
MIRT796275	hsa-miR-4472	CLIP-seq
MIRT796276	hsa-miR-449c	CLIP-seq
MIRT796277	hsa-miR-4509	CLIP-seq
MIRT796279	hsa-miR-4516	CLIP-seq
MIRT796280	hsa-miR-4520a-3p	CLIP-seq
MIRT796281	hsa-miR-455-5p	CLIP-seq
MIRT796282	hsa-miR-4638-3p	CLIP-seq
MIRT2175186	hsa-miR-4646-3p	CLIP-seq
MIRT796288	hsa-miR-4660	CLIP-seq
MIRT796290	hsa-miR-4666-3p	CLIP-seq
MIRT796292	hsa-miR-4696	CLIP-seq
MIRT796293	hsa-miR-4704-3p	CLIP-seq
MIRT796294	hsa-miR-4709-5p	CLIP-seq
MIRT796295	hsa-miR-4713-3p	CLIP-seq
MIRT1935120	hsa-miR-4724-5p	CLIP-seq
MIRT796298	hsa-miR-4728-5p	CLIP-seq
MIRT2175187	hsa-miR-4729	CLIP-seq
MIRT796300	hsa-miR-4751	CLIP-seq
MIRT796302	hsa-miR-4764-3p	CLIP-seq
MIRT796303	hsa-miR-4789-5p	CLIP-seq
MIRT796304	hsa-miR-4795-3p	CLIP-seq
MIRT1935121	hsa-miR-4797-5p	CLIP-seq
MIRT796306	hsa-miR-491-5p	CLIP-seq
MIRT796307	hsa-miR-5047	CLIP-seq
MIRT796312	hsa-miR-511	CLIP-seq
MIRT796313	hsa-miR-513b	CLIP-seq
MIRT796314	hsa-miR-515-5p	CLIP-seq
MIRT796316	hsa-miR-548aa	CLIP-seq
MIRT1935123	hsa-miR-548ae	CLIP-seq
MIRT1935124	hsa-miR-548aj	CLIP-seq
MIRT1935125	hsa-miR-548am	CLIP-seq
MIRT796318	hsa-miR-548g	CLIP-seq
MIRT796319	hsa-miR-548m	CLIP-seq
MIRT1935126	hsa-miR-548x	CLIP-seq
MIRT796320	hsa-miR-556-3p	CLIP-seq
MIRT796321	hsa-miR-567	CLIP-seq
MIRT796323	hsa-miR-576-5p	CLIP-seq
MIRT796324	hsa-miR-582-5p	CLIP-seq
MIRT796326	hsa-miR-598	CLIP-seq
MIRT796327	hsa-miR-602	CLIP-seq
MIRT796328	hsa-miR-603	CLIP-seq
MIRT796330	hsa-miR-607	CLIP-seq
MIRT796333	hsa-miR-664	CLIP-seq
MIRT2175188	hsa-miR-676	CLIP-seq
MIRT796334	hsa-miR-761	CLIP-seq
MIRT796335	hsa-miR-764	CLIP-seq
MIRT796337	hsa-miR-885-3p	CLIP-seq
MIRT796338	hsa-miR-922	CLIP-seq
MIRT796339	hsa-miR-940	CLIP-seq
MIRT796204	hsa-miR-1243	CLIP-seq
MIRT796208	hsa-miR-1266	CLIP-seq
MIRT796214	hsa-miR-153	CLIP-seq
MIRT796216	hsa-miR-185	CLIP-seq
MIRT796222	hsa-miR-19a	CLIP-seq
MIRT796223	hsa-miR-19b	CLIP-seq
MIRT796234	hsa-miR-3151	CLIP-seq
MIRT796236	hsa-miR-3168	CLIP-seq
MIRT796241	hsa-miR-329	CLIP-seq
MIRT796247	hsa-miR-362-3p	CLIP-seq
MIRT796257	hsa-miR-3941	CLIP-seq
MIRT796259	hsa-miR-4263	CLIP-seq
MIRT796261	hsa-miR-4277	CLIP-seq
MIRT796264	hsa-miR-4318	CLIP-seq
MIRT796265	hsa-miR-4320	CLIP-seq
MIRT796273	hsa-miR-4447	CLIP-seq
MIRT796274	hsa-miR-4450	CLIP-seq
MIRT796275	hsa-miR-4472	CLIP-seq
MIRT796277	hsa-miR-4509	CLIP-seq
MIRT796281	hsa-miR-455-5p	CLIP-seq
MIRT796290	hsa-miR-4666-3p	CLIP-seq
MIRT796295	hsa-miR-4713-3p	CLIP-seq
MIRT796303	hsa-miR-4789-5p	CLIP-seq
MIRT796306	hsa-miR-491-5p	CLIP-seq
MIRT796316	hsa-miR-548aa	CLIP-seq
MIRT796318	hsa-miR-548g	CLIP-seq
MIRT796319	hsa-miR-548m	CLIP-seq
MIRT796326	hsa-miR-598	CLIP-seq
MIRT796328	hsa-miR-603	CLIP-seq
MIRT796333	hsa-miR-664	CLIP-seq
MIRT796337	hsa-miR-885-3p	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796206	hsa-miR-125a-3p	CLIP-seq
MIRT796213	hsa-miR-144	CLIP-seq
MIRT796215	hsa-miR-1825	CLIP-seq
MIRT796220	hsa-miR-199a-5p	CLIP-seq
MIRT796221	hsa-miR-199b-5p	CLIP-seq
MIRT796225	hsa-miR-2053	CLIP-seq
MIRT2478393	hsa-miR-2113	CLIP-seq
MIRT796229	hsa-miR-217	CLIP-seq
MIRT2478394	hsa-miR-31	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT2478395	hsa-miR-3121-3p	CLIP-seq
MIRT2478396	hsa-miR-3126-3p	CLIP-seq
MIRT2478397	hsa-miR-3128	CLIP-seq
MIRT796238	hsa-miR-3184	CLIP-seq
MIRT796244	hsa-miR-3607-5p	CLIP-seq
MIRT2478398	hsa-miR-3665	CLIP-seq
MIRT796254	hsa-miR-3925-3p	CLIP-seq
MIRT796255	hsa-miR-3934	CLIP-seq
MIRT2478399	hsa-miR-3944-5p	CLIP-seq
MIRT796258	hsa-miR-423-5p	CLIP-seq
MIRT796263	hsa-miR-4307	CLIP-seq
MIRT2478400	hsa-miR-4315	CLIP-seq
MIRT796269	hsa-miR-4418	CLIP-seq
MIRT796285	hsa-miR-4650-5p	CLIP-seq
MIRT2478401	hsa-miR-4711-3p	CLIP-seq
MIRT796296	hsa-miR-4716-5p	CLIP-seq
MIRT2478402	hsa-miR-4720-5p	CLIP-seq
MIRT796301	hsa-miR-4757-5p	CLIP-seq
MIRT796302	hsa-miR-4764-3p	CLIP-seq
MIRT2478403	hsa-miR-4790-5p	CLIP-seq
MIRT796304	hsa-miR-4795-3p	CLIP-seq
MIRT1935121	hsa-miR-4797-5p	CLIP-seq
MIRT2478404	hsa-miR-4799-3p	CLIP-seq
MIRT1935122	hsa-miR-486-5p	CLIP-seq
MIRT796305	hsa-miR-488	CLIP-seq
MIRT796308	hsa-miR-509-3-5p	CLIP-seq
MIRT796310	hsa-miR-509-5p	CLIP-seq
MIRT796320	hsa-miR-556-3p	CLIP-seq
MIRT796321	hsa-miR-567	CLIP-seq
MIRT796324	hsa-miR-582-5p	CLIP-seq
MIRT796325	hsa-miR-587	CLIP-seq
MIRT2478405	hsa-miR-657	CLIP-seq
MIRT2478406	hsa-miR-720	CLIP-seq
MIRT796335	hsa-miR-764	CLIP-seq
MIRT796336	hsa-miR-766	CLIP-seq
MIRT1935127	hsa-miR-769-5p	CLIP-seq
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT796200	hsa-miR-101	CLIP-seq
MIRT796206	hsa-miR-125a-3p	CLIP-seq
MIRT796213	hsa-miR-144	CLIP-seq
MIRT796215	hsa-miR-1825	CLIP-seq
MIRT796220	hsa-miR-199a-5p	CLIP-seq
MIRT796221	hsa-miR-199b-5p	CLIP-seq
MIRT2478393	hsa-miR-2113	CLIP-seq
MIRT796229	hsa-miR-217	CLIP-seq
MIRT2478394	hsa-miR-31	CLIP-seq
MIRT796233	hsa-miR-3120-3p	CLIP-seq
MIRT2478395	hsa-miR-3121-3p	CLIP-seq
MIRT2478396	hsa-miR-3126-3p	CLIP-seq
MIRT2478397	hsa-miR-3128	CLIP-seq
MIRT796238	hsa-miR-3184	CLIP-seq
MIRT796244	hsa-miR-3607-5p	CLIP-seq
MIRT796254	hsa-miR-3925-3p	CLIP-seq
MIRT796255	hsa-miR-3934	CLIP-seq
MIRT2478399	hsa-miR-3944-5p	CLIP-seq
MIRT796258	hsa-miR-423-5p	CLIP-seq
MIRT796263	hsa-miR-4307	CLIP-seq
MIRT2478400	hsa-miR-4315	CLIP-seq
MIRT796269	hsa-miR-4418	CLIP-seq
MIRT796285	hsa-miR-4650-5p	CLIP-seq
MIRT2478401	hsa-miR-4711-3p	CLIP-seq
MIRT796296	hsa-miR-4716-5p	CLIP-seq
MIRT2478402	hsa-miR-4720-5p	CLIP-seq
MIRT796301	hsa-miR-4757-5p	CLIP-seq
MIRT2478403	hsa-miR-4790-5p	CLIP-seq
MIRT796304	hsa-miR-4795-3p	CLIP-seq
MIRT1935121	hsa-miR-4797-5p	CLIP-seq
MIRT2478404	hsa-miR-4799-3p	CLIP-seq
MIRT1935122	hsa-miR-486-5p	CLIP-seq
MIRT796305	hsa-miR-488	CLIP-seq
MIRT796308	hsa-miR-509-3-5p	CLIP-seq
MIRT796310	hsa-miR-509-5p	CLIP-seq
MIRT796313	hsa-miR-513b	CLIP-seq
MIRT796320	hsa-miR-556-3p	CLIP-seq
MIRT796321	hsa-miR-567	CLIP-seq
MIRT796324	hsa-miR-582-5p	CLIP-seq
MIRT796325	hsa-miR-587	CLIP-seq
MIRT2478406	hsa-miR-720	CLIP-seq
MIRT796335	hsa-miR-764	CLIP-seq
MIRT796336	hsa-miR-766	CLIP-seq
MIRT1935127	hsa-miR-769-5p	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	17363140
GO:0000785	Component	Chromatin	NAS	12192000
GO:0003677	Function	DNA binding	IDA	15640446, 23129809
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	10757798
GO:0003713	Function	Transcription coactivator activity	IDA	12200431
GO:0003713	Function	Transcription coactivator activity	NAS	8804307
GO:0005515	Function	Protein binding	IPI	11780067, 11988099, 12200431, 12368262, 15985610, 17363140, 19486893, 23540691, 23698369, 30021884, 31759698, 34591612, 35271311, 36931659
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	12200431
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006337	Process	Nucleosome disassembly	IDA	8895581
GO:0006338	Process	Chromatin remodeling	IDA	11726552
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	NAS	10078207
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	8804307, 11263494, 17340523, 17920018, 18809673
GO:0007399	Process	Nervous system development	IEA
GO:0016514	Component	SWI/SNF complex	IBA
GO:0016514	Component	SWI/SNF complex	IDA	8804307, 8895581, 9584200, 11078522, 12200431
GO:0016514	Component	SWI/SNF complex	IEA
GO:0016514	Component	SWI/SNF complex	NAS	8804307
GO:0016922	Function	Nuclear receptor binding	IPI	17363140
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	NAS	23698369, 25066234
GO:0031491	Function	Nucleosome binding	IBA
GO:0035060	Component	Brahma complex	IEA
GO:0035060	Component	Brahma complex	NAS	8804307
GO:0045582	Process	Positive regulation of T cell differentiation	NAS	12110891
GO:0045597	Process	Positive regulation of cell differentiation	NAS	11790558, 12368262
GO:0045663	Process	Positive regulation of myoblast differentiation	NAS	11175787
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	TAS	12200431
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12200431
GO:0070316	Process	Regulation of G0 to G1 transition	NAS	11790558
GO:0071564	Component	NpBAF complex	ISS
GO:0071564	Component	NpBAF complex	NAS	8804307
GO:0071565	Component	NBAF complex	IBA
GO:0071565	Component	NBAF complex	ISS
GO:0071565	Component	NBAF complex	NAS	17920018
GO:0140092	Component	BBAF complex	NAS	12368262
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	19279220
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	NAS	10778858
GO:2000781	Process	Positive regulation of double-strand break repair	NAS	16932743, 25066234
GO:2000819	Process	Regulation of nucleotide-excision repair	NAS	12215535

MIM	HGNC	e!Ensembl
603024	11110	ENSG00000117713

Protein

UniProt ID

O14497

Protein name

AT-rich interactive domain-containing protein 1A (ARID domain-containing protein 1A) (B120) (BRG1-associated factor 250) (BAF250) (BRG1-associated factor 250a) (BAF250A) (Osa homolog 1) (hOSA1) (SWI-like protein) (SWI/SNF complex protein p270) (SWI/SNF-re

Protein function

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromati

PDB

1RYU , 6LTH , 6LTJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01388	ARID	1019 → 1104	ARID/BRIGHT DNA binding domain	Domain
PF12031	BAF250_C	1976 → 2231	SWI/SNF-like complex subunit BAF250/Osa	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and PBL, and at a much lower level in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. {ECO:0000269|PubMed:11073988, ECO:00

Sequence

MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEG
PAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEP
PGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPG
SGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLT
SPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQ
PYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQ
QQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPP
QELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPG
VSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQ
IHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQ
MHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAG
MAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPER
KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGS
MQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQ
KRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYS
PSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPP
AKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQG
RNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAP
VPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGL
LAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPG
QRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASEN
SEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFE
SKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSS
TLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKR
CVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQG
VSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQ
DPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKN
PVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQN
PPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLF
LIGQS

Sequence length

2285

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling Thermogenesis Hepatocellular carcinoma		RMTs methylate histone arginines RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Coffin-Siris Syndrome	Coffin-Siris syndrome 1, coffin-siris syndrome	rs1553152590, rs797045262, rs1553153771, rs387906846	N/A
Mental retardation	Intellectual disability, autosomal dominant 14	rs797045264, rs879255270, rs1553153291, rs1557591264, rs875989848, rs1557620758, rs1557570794, rs797045262, rs875989849, rs1557612048, rs1064796564, rs1570609440, rs387906845, rs1570622663, rs387906846 View all (6 more)	N/A
neoplasm	Neoplasm	rs879255270, rs875989848	N/A

Show/Hide Unknown Diseases (10)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Astrocytoma	astrocytoma	N/A	N/A	ClinVar
autism spectrum disorder	Autism spectrum disorder	N/A	N/A	ClinVar
Breast Cancer	Breast cancer	Unexpectedly, ARID1A was also the top candidate in regard to response to the bromodomain and extraterminal domain inhibitor JQ1, but in the opposite direction, with loss of ARID1A sensitizing breast cancer cells to bromodomain and extraterminal domain inh	31913353	CBGDA
colorectal cancer	Colorectal cancer	N/A	N/A	ClinVar
Gout	Gout	N/A	N/A	GWAS
Hepatoblastoma	hepatoblastoma	N/A	N/A	ClinVar
Medulloblastoma	medulloblastoma	N/A	N/A	ClinVar
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Serous Adenocarcinoma Of Ovary	primary low grade serous adenocarcinoma of ovary	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (212)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3C syndrome	Associate	29135119
Adenocarcinoma	Inhibit	22274316
Adenocarcinoma	Associate	23525077, 28440661, 29189288, 31906887, 32572156, 34367146, 34725190, 34725203, 40101550
Adenocarcinoma Clear Cell	Associate	37697729
Adenocarcinoma Mucinous	Associate	26904685, 28440661, 33451982
Adenocarcinoma of Lung	Associate	22975805, 22980975, 33608032, 36229854, 36869329, 37327699
Adenofibroma	Associate	22157930
Adenomyosis	Associate	36708516
Aneuploidy	Associate	25963524
Anodontia	Associate	31906887, 34042312, 37906351, 40281612
Anus Neoplasms	Associate	35579625
Arthritis Juvenile	Associate	36969183
Astrocytoma	Associate	36031351
Bile Duct Neoplasms	Associate	31122820, 37139666
Biliary Tract Neoplasms	Associate	29360550, 33754015, 37139666, 37341068
Breast Neoplasms	Inhibit	22009941, 23349767
Breast Neoplasms	Associate	24430365, 26899600, 26904685, 27925203, 28112728, 30086764, 33000179, 33592583, 34063990, 34544752, 35101884, 35320351, 36332363, 36766731, 38017109
Breast Neoplasms Male	Associate	38369186
Burkitt Lymphoma	Associate	23091298, 23143597, 26468873, 31300419, 35794096, 37053555
Calcinosis Cutis	Associate	33608032
Capillary Malformation Arteriovenous Malformation	Associate	34942405
Carcinogenesis	Associate	23080032, 23650517, 23702729, 25557364, 26904685, 27873496, 28440661, 29317648, 29949775, 31392992, 31704366, 32334542, 33451982, 34386776, 34994156, 35621684, 37906351 View all (2 more)
Carcinoid Tumor	Associate	24670920, 29422640, 31300474
Carcinoma	Associate	30051528, 31309433, 35125107, 35151345
Carcinoma Acinar Cell	Associate	29109526
Carcinoma Adenosquamous	Associate	22274316
Carcinoma Basal Cell	Associate	31648686, 33928395
Carcinoma Basosquamous	Associate	31207229, 31648686
Carcinoma Ductal	Associate	23349767, 26904685, 34810298
Carcinoma Endometrioid	Inhibit	20942669, 22976498, 23080032, 23887303, 24076775, 24557437
Carcinoma Endometrioid	Associate	21412130, 22193641, 22653341, 24559118, 24979463, 26953344, 27562491, 29451900, 34257552
Carcinoma Hepatocellular	Associate	22561517, 26045782, 26589513, 28302680, 28648284, 29449409, 29487225, 30981109, 31173963, 31363003, 33407585, 33558447, 33771191, 33860125, 34174931 View all (9 more)
Carcinoma in Situ	Associate	31734230
Carcinoma Intraductal Noninfiltrating	Associate	26249178
Carcinoma Merkel Cell	Associate	36602798
Carcinoma Non Small Cell Lung	Inhibit	24566899
Carcinoma Non Small Cell Lung	Associate	32572156, 32791957, 34512623, 36126963
Carcinoma Ovarian Epithelial	Associate	27562491
Carcinoma Pancreatic Ductal	Associate	24293293, 28810144, 29486633, 30970447, 35231699, 36999792
Carcinoma Papillary	Associate	36812689
Carcinoma Renal Cell	Associate	22101352, 23644518, 23792563, 25081752, 26043110, 26864202, 27340867, 27601542, 28718916, 29451900, 32868822, 32975815, 33000179, 33608032, 36857998
Carcinoma Renal Cell	Inhibit	22976498, 22977660, 23416164, 24557437
Carcinoma Signet Ring Cell	Associate	32727394, 35618879
Carcinoma Small Cell	Associate	31186531, 35662501
Carcinoma Squamous Cell	Associate	25776029, 34725203, 35783357
Carcinoma Transitional Cell	Associate	21822268
Carcinosarcoma	Associate	22653804, 25233892, 27009459, 29659191
Cholangiocarcinoma	Associate	24185509, 24563076, 24867389, 25526346, 25536104, 27433094, 28297679, 28648284, 29740198, 29848569, 30849962, 32293336, 32631434, 33535978, 33579226 View all (8 more)
Cholestasis Intrahepatic	Associate	35726602
Chondroma	Associate	35151345
Coffin Siris syndrome	Associate	34180430, 34942405, 35579625, 39355979
Colitis Ulcerative	Associate	28524162
Colonic Neoplasms	Associate	26980037, 29955144
Colonic Neoplasms	Inhibit	31217031
Colorectal Neoplasms	Associate	22009941, 22810696, 24599305, 25561809, 26980037, 28440661, 30804124, 31040255, 31217031, 31796878, 32334542, 32568634, 33028695, 33080474, 33414133 View all (8 more)
Colorectal Neoplasms	Inhibit	24833095
Colorectal Neoplasms	Stimulate	32166754
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	23702729, 29588532, 36918055
Congenital Abnormalities	Associate	39355979
Cysts	Associate	22976498
Desmoplastic Small Round Cell Tumor	Associate	32393201
Developmental Disabilities	Associate	34753942, 34942405
Disease	Associate	36153585, 39355617
DNA Repair Deficiency Disorders	Associate	33662100
Dubowitz syndrome	Associate	33098347
Ectodermal Dysplasia	Associate	34942405
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	22653804
Endocrine System Diseases	Associate	36332363
Endodermal Sinus Tumor	Associate	34117242
Endometrial Hyperplasia	Associate	23080032, 24076775
Endometrial Neoplasms	Associate	22653341, 22653804, 23028188, 23080032, 23104009, 23524907, 25557364, 27348297, 28448305, 28485815, 28863077, 30358215, 31308508, 31686413, 32473611 View all (14 more)
Endometrial Neoplasms	Inhibit	23702729, 23887303, 24557437
Endometriosis	Associate	20942669, 22157930, 22301703, 23962610, 25692284, 28483516, 29131266, 29135119, 32473611, 32868822, 35616875
Endometriosis	Inhibit	22977660
Epilepsies Partial	Associate	37563306
Epstein Barr Virus Infections	Inhibit	34469459
Epstein Barr Virus Infections	Associate	37434198
Ermine phenotype	Associate	27873496
Esophageal Squamous Cell Carcinoma	Associate	25757668, 26812616, 30350313, 31851786
Esophageal Squamous Cell Carcinoma	Inhibit	29866946
Familial cylindromatosis	Associate	29135119, 31906887
Fibrocystic Breast Disease	Associate	33382535
Gallbladder Neoplasms	Associate	33813726
Ganglioneuroma	Associate	35151345
Gastritis Atrophic	Associate	30249557
Gastro enteropancreatic neuroendocrine tumor	Associate	32883742
Gastrointestinal Neoplasms	Associate	35239432
Gastrointestinal Stromal Tumors	Associate	31570771
Genital Neoplasms Female	Associate	25776029
Glassy cell carcinoma of the cervix	Inhibit	22274316
Glioma	Associate	36031351
Glucocorticoid Receptor Deficiency	Associate	36344675
Graft vs Host Disease	Inhibit	36789575
Growth Disorders	Associate	37605180
Growth Disorders	Stimulate	39355979
Hereditary pancreatitis	Associate	24979463
HIV Infections	Associate	40634688
Hydrocephalus	Associate	34942405
Hyperplasia	Associate	29588532, 32187665
Hypoalphalipoproteinemias	Associate	36510654
Hypotrichosis	Associate	34545858
Immunologic Deficiency Syndromes	Inhibit	33541386
Inflammation	Associate	30301863
Inflammatory Bowel Diseases	Associate	32697969
Inflammatory Breast Neoplasms	Associate	30086764, 31854063
Intellectual Disability	Associate	27906199
Intellectual Disability	Stimulate	39355979
Intestinal Diseases	Associate	37890493
Kidney Neoplasms	Associate	23416164
Lead Poisoning Nervous System	Associate	37730563
Leukemia Myeloid Acute	Associate	33560403, 34042280
Leukemia Promyelocytic Acute	Associate	27063598
Liposarcoma	Associate	27562491
Lung Diseases	Inhibit	22009941
Lung Diseases	Associate	28448305
Lung Neoplasms	Inhibit	24566899
Lung Neoplasms	Associate	32572156, 33407425
Lymphatic Metastasis	Associate	24430365, 25561809, 25717252, 29135119
Lymphatic Metastasis	Inhibit	24566899
Lymphoma	Associate	39843653
Lymphoma B Cell Marginal Zone	Associate	25779943
Lymphoma Follicular	Associate	22585168, 24435047, 27102345, 34649275, 34791836, 36240289, 39843653
Lymphoma Large B Cell Diffuse	Associate	23292937, 27102345, 36240289, 37032379, 40634688
Lymphoma Non Hodgkin	Associate	32883742
Lymphoproliferative Disorders	Associate	37705050
Mastocytosis Systemic	Associate	33327223
Medulloblastoma	Inhibit	22009941
Melanoma Cutaneous Malignant	Associate	26744134
Meningeal Carcinomatosis	Inhibit	35125107
Meningioma	Associate	25963524, 33087175
Metabolic Diseases	Associate	37800816
Microcephaly	Associate	27906199
Microsatellite Instability	Inhibit	22009941
Microsatellite Instability	Associate	23702729, 36918055
Microsatellite Instability	Stimulate	33028695
Mouth Diseases	Inhibit	22301703
Mouth Diseases	Associate	36812689
Multiple Myeloma	Associate	29389935
Muscle Hypotonia	Associate	34942405
Myocardial Ischemia	Associate	37543677
Nail Diseases	Associate	34942405
Neoplasm Invasiveness	Inhibit	31217031
Neoplasm Metastasis	Inhibit	24566899, 29177569, 34183353
Neoplasm Metastasis	Associate	25561809, 27348297, 28440661, 28448305, 29486199, 33860125, 36420658, 36869329, 37232011
Neoplasms	Associate	11159203, 19091943, 20942669, 21412130, 22009941, 22976498, 23202128, 23355908, 23416164, 23636398, 23650517, 23887303, 24023729, 24185509, 24817979 View all (123 more)
Neoplasms	Inhibit	20826764, 21614196, 22157930, 22193641, 22274316, 22301703, 22653341, 22808142, 22977660, 23028188, 23080032, 23097632, 23349767, 23524907, 23702729 View all (31 more)
Neoplasms Cystic Mucinous and Serous	Associate	23104009
Neoplasms Germ Cell and Embryonal	Associate	27572311
Neoplasms Glandular and Epithelial	Associate	31309433
Neoplasms Squamous Cell	Associate	33227989
Neural Tube Defects	Associate	25293959
Neuroblastoma	Associate	11159203, 23202128
Neuroendocrine Tumors	Inhibit	11159203
Neuroendocrine Tumors	Associate	27994516, 29486199, 35739266, 39447548
NF1 Microduplication Syndrome	Associate	27906199
Non Muscle Invasive Bladder Neoplasms	Associate	28339163, 30138427, 31386310, 32449441, 39817975
Obesity	Associate	29500370, 37305395
Olfaction Disorders	Associate	38369189
Osteosarcoma	Inhibit	29177569
Ovarian Cysts	Associate	22976498
Ovarian Diseases	Associate	21412130, 22653341, 22977660, 24979463, 26953344, 32868822, 35616875
Ovarian Neoplasms	Associate	20826764, 20942669, 21614196, 22009941, 22301703, 22977660, 23524907, 23962610, 24023729, 24336158, 24338723, 24559118, 25081752, 25551281, 25692284 View all (39 more)
Ovarian Neoplasms	Inhibit	22101352, 22157930, 22193641, 22976498, 24076775, 33541386, 33826602
Overweight	Associate	29500370
Pancreatic Neoplasms	Associate	22233809, 24293293, 26154128, 31688591, 33350171, 33662100, 33941236, 34375311
Parkinson Disease	Associate	32868381
Penile Neoplasms	Associate	25776029
Peripheral Nervous System Neoplasms	Associate	37195520
Peritonitis	Associate	30804124, 32166754
Pinealoma	Associate	27282397
Precancerous Conditions	Associate	36078038
Prodromal Symptoms	Associate	37563306
Prostatic Neoplasms	Associate	33323379
Prostatic Neoplasms Castration Resistant	Associate	30620391
Prostatitis	Associate	22009941
Pulmonary Disease Chronic Obstructive	Inhibit	30350313
Pulmonary Disease Chronic Obstructive	Associate	36420658
Recombinant chromosome 8 syndrome	Associate	34510272
Respiration Disorders	Associate	37939712
Respiratory Tract Infections	Associate	26278805, 33588785, 39513266
Retinal Dysplasia	Associate	33451982, 34942405
Retinoblastoma	Associate	32139107
Rhabdoid Tumor	Associate	35125107
Sarcoma	Associate	29801054, 32461620, 35125107
Sarcoma Ewing	Associate	31392992
Sarcoma Myeloid	Associate	33327223
Schwannomatosis	Associate	32281771
Sclerosing lymphocytic lobulitis	Associate	34942405
Septo Optic Dysplasia	Associate	35885948
Sezary Syndrome	Associate	26415585, 26551670
Sinonasal undifferentiated carcinoma	Associate	28291122, 36443295, 38369189
Spinocerebellar Degenerations	Associate	34042312
Squamous Cell Carcinoma of Head and Neck	Associate	36362284
Stenosis Pulmonary Vein	Associate	27433094
Stomach Diseases	Associate	22808142, 29317648, 33451982
Stomach Neoplasms	Inhibit	21412130, 22009941, 26400522, 30249557
Stomach Neoplasms	Associate	22808142, 23887303, 25583476, 25717252, 25882375, 26334097, 28522256, 29317648, 30747208, 31043675, 31308508, 31704366, 31790410, 31912865, 31922331 View all (22 more)
Subcutaneous panniculitis like T cell lymphoma	Associate	37800816
Thymus Neoplasms	Associate	34942405
Triple Negative Breast Neoplasms	Associate	29392887, 35022313
Turcot syndrome	Associate	25717252, 32060377, 32620917, 33676104, 34897700
Turcot syndrome	Inhibit	26980037, 32572156
Unilateral Breast Neoplasms	Associate	31848314
Urethral Neoplasms	Associate	30301863, 38219954
Urinary Bladder Neoplasms	Associate	23650517, 28583311, 30138427, 31386310, 31393349, 31891283, 32012118, 33588785, 34793662, 37084735, 37718188, 39892702
Urologic Neoplasms	Associate	34200508
Uterine Cervical Neoplasms	Associate	28112728, 32951893, 34994156, 36344675, 36510654
Uterine Neoplasms	Associate	34646088
Uveitis	Associate	36969183
Vulvar Neoplasms	Associate	37114627
Waldenstrom Macroglobulinemia	Associate	24366360, 27301862, 32791817, 34462944
Wilms Tumor	Associate	25190313, 28825729

ARID1A (AT-rich interaction domain 1A)