Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8269
Gene name Gene Name - the full gene name approved by the HGNC.	Transmembrane protein 187
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TMEM187
Synonyms (NCBI Gene) Gene synonyms aliases	CXorf12, DXS9878E, ITBA1
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq28
Summary Summary of gene provided in NCBI Entrez Gene.	This gene consists of two exons and encodes a multi-pass membrane protein. An alternatively spliced transcript variant encoding the same protein has been found, but its biological validity is not determined. [provided by RefSeq, May 2010]

Show/Hide all(32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029254	hsa-miR-26b-5p	Microarray	19088304
MIRT1433877	hsa-miR-147	CLIP-seq
MIRT1433878	hsa-miR-148a	CLIP-seq
MIRT1433879	hsa-miR-148b	CLIP-seq
MIRT1433880	hsa-miR-152	CLIP-seq
MIRT1433881	hsa-miR-383	CLIP-seq
MIRT1433882	hsa-miR-3978	CLIP-seq
MIRT1433883	hsa-miR-4261	CLIP-seq
MIRT1433884	hsa-miR-4436b-3p	CLIP-seq
MIRT1433885	hsa-miR-4772-5p	CLIP-seq
MIRT1433886	hsa-miR-494	CLIP-seq
MIRT1433887	hsa-miR-581	CLIP-seq
MIRT1433888	hsa-miR-607	CLIP-seq
MIRT2351519	hsa-miR-873	CLIP-seq
MIRT2645192	hsa-miR-214	CLIP-seq
MIRT2645193	hsa-miR-3117-5p	CLIP-seq
MIRT2645194	hsa-miR-3619-5p	CLIP-seq
MIRT2645195	hsa-miR-4291	CLIP-seq
MIRT2645196	hsa-miR-4330	CLIP-seq
MIRT2645197	hsa-miR-4731-5p	CLIP-seq
MIRT2645198	hsa-miR-4769-3p	CLIP-seq
MIRT2645199	hsa-miR-637	CLIP-seq
MIRT2645200	hsa-miR-657	CLIP-seq
MIRT2645201	hsa-miR-759	CLIP-seq
MIRT2645202	hsa-miR-761	CLIP-seq
MIRT2645203	hsa-miR-922	CLIP-seq
MIRT2645193	hsa-miR-3117-5p	CLIP-seq
MIRT2645196	hsa-miR-4330	CLIP-seq
MIRT2645197	hsa-miR-4731-5p	CLIP-seq
MIRT2645198	hsa-miR-4769-3p	CLIP-seq
MIRT2645199	hsa-miR-637	CLIP-seq
MIRT2645201	hsa-miR-759	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005515	Function	Protein binding	IPI	32296183
GO:0008150	Process	Biological_process	ND
GO:0016021	Component	Integral component of membrane	IEA
GO:0030133	Component	Transport vesicle	IBA	21873635
GO:0030133	Component	Transport vesicle	IDA

MIM	HGNC	e!Ensembl
300059	13705	ENSG00000177854

Protein

UniProt ID

Q14656

Protein name

Transmembrane protein 187 (Protein ITBA1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15100	TMEM187	8 → 245	TMEM187 protein family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLV
NMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTL
PIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALR
THRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFA
FLFLTHFNTHPRFHPSGGKTR

Sequence length

261

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	23143596

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Celiac disease	Celiac Disease, Celiac disease	22057235, 23143596	ClinVar, GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	28271077
Celiac Disease	Associate	26859134, 38072919
Osteoporosis	Associate	37710308

TMEM187 (transmembrane protein 187)